KEGG   Streptomyces noursei: SNOUR_28660Help
Entry
SNOUR_28660       CDS       T04806                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
snr  Streptomyces noursei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ANZ18977
UniProt: A0A1B2GYI4
LinkDB All DBs
Position
6472125..6473576
Genome map
AA seq 483 aa AA seqDB search
MSDLVEHGKLYIGGELVDPAGSETIEVVSPHSEQVIGRVPHAARADVDRAVAAARASFES
GVWANAPLDERIAVVSRIKDAFAVRSEEFARVIGAQNGTPVTSGVMVQSLAAMMAWDAAL
TVAREFPFEERRAGVLGPLLVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCSVVLKV
SPETPLDAYLLAEIVTEAGLPEGVLSILPADREVSEYLVGHPGVDKVSFTGSVAAGKRVM
EVAARNLTRVTLELGGKSAAVILPDADLDAAVAGIVPFAWMINGQACVAQTRILAPRSRY
DEIAERFAAAAGALTVGDPLDPATEVGPLVARRQQQRSLDYIALGQKEGAEVLTGGGRPK
GRSTGWYVEPTLFGGVDNGMRIAREEIFGPVICLLPYGDEEEAVRIADDSEYGLSGSVWT
ADVERGIDIARRVRTGTYSVNTFSIDMLGPFGGYKNSGIGREFGPEGFGEYLEHKMIHLP
AGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacctcgtcgagcacggaaagctctatataggcggtgagttggtcgacccggcc
ggctcggaaacgattgaggtcgtctcgccgcacagcgagcaggtcatcgggcgggtgccg
cacgccgcgcgggccgatgtggaccgggcggtggccgccgcccgggcgtccttcgagtcg
ggggtgtgggcgaacgccccgttggacgagcggatcgcggtggtgagccggatcaaggac
gcgttcgcggtgcgcagcgaggagttcgcgcgggtcatcggcgcgcagaacgggacgccg
gtcacctcgggcgtgatggtgcagtcgctggccgcgatgatggcgtgggacgcggcgctc
acggtggcgcgggagttcccgttcgaggagcggcgggccggggtgctggggccgctgctg
gtgcggcgggagccggtgggggtggtcgcggccgtcgtgccgtggaacgtcccgcagttc
accgccgccgccaagctcgcgccggcgctgctggccgggtgctcggtggtgctgaaggtc
tcgccggagaccccgctggacgcctatctgctcgcggagatcgtgacggaggcggggctg
ccggagggggtgctgtcgatcctgccggccgaccgggaggtcagcgagtacctggtcggg
cacccgggcgtggacaaggtgtcgttcaccgggtcggtggcggccggcaagcgggtcatg
gaggtggcggcccgcaacctcacgcgggtgacgctggagttgggcggcaagtcggcggcg
gtgatcctgccggacgcggatctggacgcggcggtcgccgggatcgtgccgttcgcctgg
atgatcaacgggcaggcgtgcgtggcgcagacccggatcctcgccccgcgcagccgttac
gacgagatcgccgagcggttcgccgcggcggcgggcgcgttgaccgtcggcgacccgctg
gatccggccacggaggtcgggccgctggtcgcccgtcgccagcagcagcgctcgctggac
tacatcgcgttggggcagaaggaaggcgccgaggtgctgaccggcggcggccggccgaag
gggcggtcgaccggctggtacgtcgagccgacgctcttcggcggggtcgacaacgggatg
cggatcgcgcgggaggagatcttcgggccggtgatctgcctgctgccgtacggggacgag
gaggaggcggtgcggatcgccgacgactcggagtacgggctgtcggggtcggtgtggacg
gcggacgtcgagcgcggcatcgacatcgcgcgacgggtgcggaccgggacgtactcggtg
aacaccttcagcatcgacatgctcgggccgttcggcggctacaagaactccggcatcggg
cgggagttcgggcccgaggggttcggcgagtacctggagcacaagatgatccacctgccg
gcgggtgcctga

DBGET integrated database retrieval system