KEGG   Streptomyces noursei: SNOUR_33110Help
Entry
SNOUR_33110       CDS       T04806                                 

Definition
(GenBank) Isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
snr  Streptomyces noursei
Pathway
snr00020  Citrate cycle (TCA cycle)
snr00480  Glutathione metabolism
snr01100  Metabolic pathways
snr01110  Biosynthesis of secondary metabolites
snr01120  Microbial metabolism in diverse environments
snr01130  Biosynthesis of antibiotics
snr01200  Carbon metabolism
snr01210  2-Oxocarboxylic acid metabolism
snr01230  Biosynthesis of amino acids
Module
snr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
snr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNOUR_33110
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SNOUR_33110
Enzymes [BR:snr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SNOUR_33110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ANZ19854
UniProt: A0A1B2H0Z6
LinkDB All DBs
Position
7483914..7486136
Genome map
AA seq 740 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVEAYAATAGVTLETRDISLSGRIIASFPERLKEDQ
RIADALAELGQLAKTPGANIIKLPNISASIPQLKAAIAELQEQGYALPDYPDDPKTDEER
ETRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTADSKTNVATMGEND
FRSTEKSAVIAEDGSLRIELVAEDGTTTVLRESVPVLAGEVVDASVMRVAQLREFLAAQV
ARAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFARYGEALAAAGLTPNDGLGGI
FKGLEALPDGAEIKASFDAELAEGPELAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTLAVLPDSSYAGIYQAVIDDCRAHGAFDPATMGSVPNVGLMAQKAEEYGS
HDKTFEVAVAGTVRLVDAQGNVVIEQAVAAGDIFRACQTKDAPIKDWVKLAVSRARATGD
PAVFWLDETRAHDAQLIAKVNAYLSEHDTEGLEIKILAPVEATAFSLERIRRGANTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLATTTDNTRAKVLADTLDRATGSFLNENRSPSRKLGGIDNRGSHFY
LALYWAQELAKQTDDAQLAEAFGPLAKTLTEQEQTIVDELIAVQGSPVDIGGYYRPDPAK
ASAVMRPSKTLNQALAALQG
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatttacacccacactgacgaggccccggccctggcgacgtac
tcgttcctgccggtggtggaggcgtacgccgcgacggccggggtgacgctggagacccgc
gacatctccctgtcgggccggatcatcgccagcttccccgagcgcctgaaggaggaccag
cggatcgccgacgccctcgcggagctcggccagctggccaagacccccggcgcgaacatc
atcaagctgccgaacatctcggcctccatcccgcagctcaaggcggccatcgccgagctc
caggagcagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgc
gagacccgcgcccgctacgacaaggtcaagggcagcgccgtcaaccccgtgctgcgcgag
ggcaattcggaccgccgggcgcccgcgtcggtgaagaactacgccaaggcgcacccgcac
cgcatgggcgcctggaccgccgactccaagaccaacgtcgcgaccatgggcgagaacgac
ttccgctccaccgagaagtccgcagtgatcgccgaggacggctccctgcgcatcgagctg
gtggccgaggacggcaccaccaccgtgctgcgcgagtcggttccggtgctcgcgggcgag
gtggtggacgcctccgtcatgcgcgtcgcccagctccgtgagttcctcgccgcccaggtc
gcgcgcgccaaggcggagggcgtgctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcgtcttcggccacgtcgtacgggccttcttccccaagaccttcgcc
cggtacggcgaggcgctggccgcggccggcctcaccccgaacgacggcctcggcggcatc
ttcaagggcctggaggcgctgcccgacggcgccgagatcaaggcgtccttcgacgccgag
ctggccgagggcccggagctggccatggtcgactccgaccggggcatcaccaacctgcac
gtccccagcgacgtcatcgtggacgcgtccatgcccgcgatgatccgcacctccggccac
atgtggggtccggacggacaggaggcggacaccctcgcggtgctccccgacagcagctac
gccggcatctaccaggccgtcatcgacgactgccgggcgcacggcgcgttcgacccggcc
accatgggctcggtgccgaacgtcggcctgatggcgcagaaggccgaggagtacggctcc
cacgacaagaccttcgaggtcgcggtcgcgggcaccgtccgcctggtcgacgcgcagggc
aacgtcgtcatcgagcaggccgtcgccgccggtgacatcttccgcgcctgccagaccaag
gacgcgccgatcaaggactgggtcaagctggccgtcagccgcgcccgcgccaccggcgac
ccggcggtgttctggctcgacgagacccgcgcgcacgatgcccagctgatcgcgaaggtc
aacgcctacctgtcggagcacgacaccgagggcctggagatcaagatcctggccccggtc
gaggcgaccgcgttctccctggagcggatccgccgcggcgcgaacaccatctcggtcacc
ggcaacgtcctgcgcgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctctcggtcgtcccgctgatgaacggcggcggcctgttcgagaccggtgcc
ggtggttccgcccccaagcacgtccagcagctggtcaaggagaactacctgcgctgggac
agcctgggcgagttcctcgcgctggcggtcagcttcgagcacctcgcgacgaccacggac
aacacccgtgccaaggtcctcgccgacaccctcgaccgcgcgaccggttcgttcctcaac
gagaacaggtcgccgagccgcaagctgggtggcatcgacaaccgcggcagccacttctac
ctggcgctctactgggcccaggagctggccaagcagaccgacgacgcgcagctcgccgag
gcgttcgggccgctggccaagacgctgaccgagcaggagcagaccatcgtcgacgagctg
atcgcggtgcagggctccccggtcgacatcggcggctactaccgccccgacccggccaag
gcgtccgcggtgatgcgtccctcgaagacgctgaaccaggcgctggcggccctgcagggc
tga

DBGET integrated database retrieval system