KEGG   Streptomyces noursei: SNOUR_41085Help
Entry
SNOUR_41085       CDS       T04806                                 

Definition
(GenBank) zinc-containing alcohol dehydrogenase
Organism
snr  Streptomyces noursei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ANZ21445
UniProt: A0A1B2H5F5
LinkDB All DBs
Position
complement(9189198..9190196)
Genome map
AA seq 332 aa AA seqDB search
MRAVVVHTPGHYEVTTVADPAPGPGEVVIAPAAVGICGTDAHIVDGEFAPTPYPIVPGHE
FTGEVVALGAGVTGLRTGEQVAVDPSLFCGACHFCAIGRGNLCENWGAIGDTVDGAMAEY
VKVPAANCYRLPEGIEVSQGTLIEPLSCAVRGFDVLPRRLGDHYLIYGAGTMGLMMLQLA
RTAGAASLSVVDLNTDRLRVAEQLGADATAVSAAQLDRPQGWETVIDCTGAIPVIEDGLT
RVRRGGTFQQFGVAPSAAAASFSPFRVYNDEITIVGSMAVLHSFGRAVDLMAKGVIDADT
MITHRYALDDFGTALQTFRQGTGRKIQICPQA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgtcgtcgtccacactcccgggcactacgaggtcaccaccgtcgccgatccc
gccccgggtccgggcgaggtcgtcatagcccccgccgccgtcggcatctgcggcaccgac
gcacacatcgtcgacggggaattcgcccccaccccctacccgatcgtccccggccacgaa
ttcaccggcgaagtcgtcgcactgggcgccggcgtcaccggcctgcgcaccggcgaacag
gtcgccgtcgacccgtccctgttctgcggcgcatgccacttctgcgccatcggtcgcggc
aatctctgcgagaactggggcgcgatcggggacaccgtggacggcgccatggccgagtac
gtcaaggtgccggccgccaactgctaccgccttcccgaaggcatcgaagtctcccagggc
acgctcatcgaaccgctgtcctgcgcggtgcgcggcttcgacgtacttccccgccgcctg
ggcgaccactacctcatctacggcgccggcaccatgggcctgatgatgcttcagctcgcc
cgaaccgccggcgcggcatccctctccgtcgtggacctcaacaccgaccgcctgcgggtc
gccgaacaactcggcgcggacgccacggcggtcagcgccgcacagctggaccgcccgcag
ggatgggagaccgtcatcgactgcaccggcgccatcccggtcatcgaggacggcctcacc
cgggtccgccgcggtggcaccttccagcagttcggcgtcgcgccgtccgcggccgcggcg
tccttctccccgttccgggtctacaacgacgagatcaccatcgtcggctcgatggccgtc
ctgcacagcttcggccgcgccgtcgacctcatggcgaagggcgtcatcgacgccgacacc
atgatcacccaccgctacgccctggacgacttcggcaccgccctccaaaccttccgccag
ggcaccggccgcaagatccaaatctgcccgcaggcctga

DBGET integrated database retrieval system