KEGG   Streptomyces noursei: SNOUR_41405Help
Entry
SNOUR_41405       CDS       T04806                                 

Gene name
pteA1
Definition
(GenBank) modular polyketide synthase
Organism
snr  Streptomyces noursei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt KR Acyl_transf_1 Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N Epimerase Polysacc_synt_2 GDP_Man_Dehyd PKS_DE Docking RmlD_sub_bind ACP_syn_III NmrA 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: ANZ21509
UniProt: A0A1B2H5U4
LinkDB All DBs
Position
9314403..9334808
Genome map
AA seq 6801 aa AA seqDB search
MSNEEKLREYLKRAIADLHETRQQLDETEAKQREPIAIVSMACRFPGGVRAPEELWALLR
DGVDAISSFPRNRGWDLEALFHPDPAHQGTAYAREGGFLHEAGEFDPAFFGISPREALAM
DPQQRLLLETAWEAVEHAGIDPQSLAGSQTGVFVGTGHGGYDAEGGRRADEVGGHLLTGN
HISIASGRISYVLGLEGPALTVDTACSSSLVALHLAMHALRRGECAMALVGGATVMSTPQ
MFVEFSRQRGLAPDGRCKPFAAAADGTGWSEGVGLLVVERLSDAVRNGHPVLAVLKGSAV
NQDGASNGLTAPNGPSQQRVIRQALAGAGLAASDIDAVEAHGTGTTLGDPVEAHALLATY
GQQRPADRPVLIGSMKSNIGHTQAAAGIAGVMKMVLAMRHGQLPRTLHLDAPTGHVDWSE
GTARLLAEPEPWPSTDRPRRAAVSSFGISGTNAHVILEQAPAHAAEPAAEQAARSGALPW
ILSARTEAALRAQAERLSRHVRDRAGLEPTAVAHALVDTRALMEHRAVVVADDRDALVEG
LDALAAGRGATGLVSGVAAKTTTAFLFAGQGSQRLGMGRELHAAHPEFASAFDAVCAELD
PHLDRPLRDVVFADEGSADAALLDRTAYTQAALFALETALFRLVESWGVAPRFVAGHSIG
ELAAAHVSGVLTLEDAARLVAARGTLMQALPEGGAMVAIQATEEEIRDSLAGHEAHVSLA
AANGPDSTVISGDEQAVTEIAAHWADHGRRTKRLRVSHAFHSPHMDAMLEDFRSVARDLT
FHAPRIPVVSTVTGELATEDELRSPDYWVRQVREAVRFCAAVRTLEAEGVTTFVEIGPDG
VLTPMVQDCLTTLDGPVPPVLVPLLRAGRPEDFTLTTGIATAFAHGAHVDWAGCLGTRNA
PHVALPTYAFQRQWYWLDPADPEPAEAATAVAGEAGFWAAVEREDLQELSAVLAIDGSDA
DSLGNLLPTLSSWHRRRRIQATADRLGYHTHWAPRTVTDNPAAAGHWLVVLPHGRADDPW
TVRLLDALRDQGLHTDVRELPDTDEPGDALARTDTPFDGVLSLLALDERAHPHLPALPRG
VAATAGLLRALETAGIQAPLWCLTRGAVAVDRHEALTSPVQAQTWGLGRVAALESPQTWG
GLVDLPENPDGRAVAALLRTLAGEEDQVAIRPTGVFTRRLERVAPGDTDAPWHAHGTVLV
TGGTGALGTHLAHWLAGAGAQHLVLTSRRGPQAPGAPELAAALTDRGVEVTLAACDAADR
DALAAVLADIPAHLPLTGVVHAAGVLDDGVLDALTPERFETVLRPKAQAARNLHELTQDL
DLDHFVLFSSIVGVLGNPGQANYAAANAYLDALAEQRHRQGLPATSVSWGPWAGDGMATD
SDAADRMSRDGLLPLPAAPALAALRQALAQGMTHVTVADIDWSAYAPALTAVRPSPLIAD
LPEARRAIRPADGPRRGASPLRERIGALPPAEQEQAFLAMVREEAAKVLGHPSPDTVDVQ
RAFREQGFDSLMAVDLRNRLSAATGLRLPTTLLFDHPSSVAVAAYLRAEVLGAAGPATVV
QASAAALDEPVAIVGMACRFPGGVDSPAALWRLLAEGGDAITPMPTDRGWDLDRLYHSDP
DHQGTTYARGGGFLDGVAGFDADFFGISPREALAMDPQQRLLLETTWEVLEQAGIDPESL
RGSSTGVFAGTNTQDYGAVLDTAQDEAGGHRLTGNALSVVSGRVSYTFGFEGPAVTVDTA
CSSSLVALHMAAQALRQGECSLAVAGGVTVMSTPSSFVEFARQRGLAPDGRCKPFASAAD
GTGWSEGVGLLLVERLSDARRNGHQVLAVVRGSAVNQDGASNGLSAPSGPSQQRVIRQAL
ANAQLAASEVDAVEAHGTGTTLGDPIEAQALLATYGQEHPPEQPLLLGAVKSNLGHTQAA
AGVAGVMKMVLAMRHGMLPRTLHVDEPTGHVDWTAGAVELLTENTDWPDTGHPRRAAVSA
FGISGTNAHVVLELPAATEPEAPATPVGTVPLLLSAKSGSALRAQAARLHSHLDREPALR
LADVAHALITRRTAFAHRATVRADDHATALRALTALAAGEADPALDTGTAHTGRDAVLFS
GQGSQRLGMGRELYAGHPVFAAAFDAVCAALDEHLDRPLRDVVWGEDADELNRTVYAQAG
LFALEVALFRLVESWGVSPQYVAGHSVGEIAAAHVAGVFSLADACALVAARGRLMQALPA
GGAMVALQATEEEVLPHLTDDVALAAVNGPRATVVSGTEAAVLALAAHFEAEGRKTTRLR
VSHAFHSPLMEPMLDDFRAVAEGLSYGEPERSVVSNVTGELATEDRLRTPEYWVTHVRAA
VRFADGIRTLHAQGVTRFLELGPDGTLTAMARESLPDDGATDRSAPDEGVLAPALRRDRP
EEATLLAALTQLHVSGAEIDWTSFPAARDARPVDLPTYAFQHQRFWPTPDHTRTGDIGAV
GLEAAGHPLLSAAVELPDGDGVLFTTRLSLATHPWLAGHAIMGSVLLPGTAFVELAVRAA
DEAGCERVEELTLAAPLILPEHGGVHLQLHVGPADEAGRRTFSARSRAEGDGDHPWVQHA
TGVLAVDPQPAATDVDLAAMPWPPADAEPVELTDFYPRLADRGFDYGPHFQGLRAAWRRG
DEVFADVALPVAAEGEAPAYGLHPALLDAALHIVTFNGIEQDVVPFAWENVSLHASGAAA
VRVRVTRHGNDTVSVDVADTTGEPVATIGALVLRTVSADQWHSGTAPIGRDALFRLRWDP
VRLPPVDAVETVAAVGLATDPAAGWSTELIEHYADLDALAAAGRAPGAVLTPVTTDLDGP
GTVEAVHAATARTLAAMQSWLADDRFASSRLVFVTRGAVSGADLAGAAVWGLVRSAQSEN
PGRFGLVDLDTDAETDLLPMALASDEPQLSLRGGEVLVPRLARAQAQRKHVWDTAGTVLI
TGGTGGLGRTVARHLVVEHGVRSLLLVSRRGRAAEGAGELVAELAEHGAQVVVEACDVTD
AAAVQDLISRHVPSVVVHTAGVLDDGVVGTLTPERLAAVLRPKVDAAWHLHEATKDLDLD
AFVVFSSVAGAIGSPGQANYAAGNSFLDGLAHHRRAAGLPAVSMAWGPWSQDSGMTGTLT
DADLQRIARQGMPPLSVEQGVALFDAALAAGDAHMLPVRFDLAGLREQGAVPPLLRGLIR
TRTRRSVVAGSAAVAGLVGRLSALGAAERREALLDLVRAQIAVVLGHANPETIDPDRAFN
DLGFDSLTGVELRNRLNDATGMLLSSTAVFDYPTAGTLVGFLLDELFDSPEEAHAPTVPS
PTGAADDPVVIVGMSCRYPGGVASPEDLWRLVSDGADAVSDFPTDRGWDLEALHNPDPEA
FGTSYTRSGGFLHEAPEFDPEFFGMSPREALATDSQQRLLLETTWEAIERTGIDPTSLRG
SRTGVFAGVMYTDYEDLLGGDQFEGFRSNGSAASIASGRVSYTFGFEGPAVTVDTACSSS
LVALHLAAQALRAGECSLALAGGVTVMSTPTTFVEFSRQRGLAADGRCKAFSDAADGVGW
GEGVGMLVLERLSDARRLGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALASAG
VSAADVDAVEAHGTGTTLGDPIEAQALLATYGRERPDDRPLLLGTVKSNIGHAQAASGVA
GVIKMVLAMRHGVLPRTLHVDEPSTHVDWSAGAVELLTSETEWPQGTGPRRAGVSSFGVS
GTNAHVILEQPEPIADDAVPDAVEDEPGALAWVLSGRSESALRGQAARLLPLVAGRDARS
ARDIGHSLVTGRTRFPHRAVVWGQDRDALVLALSALAVGETYTGLAEGTSDAGKTAFLFS
GQGSQRLGMGRELYGRYPVFAAAFDAVCAALDEHLERPVRDVVWGEDAEALNQTAYAQAG
LFAIEVALYRLAESWGVRADFVTGHSIGEVAAAHVAGVLSLPDAGALVAARGRLMQALPA
GGTMVALRATEEEVLPHLTGEVSIAAVNGPSSVVVSGAQDAVLAVAAHFEAEGRKTTRLR
VSHAFHSPLMEPMLDDFRAVVARLSLGTPTIPVVSNLTGRLAEPEHLCRADYWVRHVREA
VRFADGVETLHAAGVTRFLELGPDGVLSAMARESLPDEAVLAPVLRKNRPEETTLLGALA
QLYVRGGDVDWASLYAGKGARWVDLPTYAFQRERFWPSTRVVRSGDVRFAGLDSAEHPLL
GAAVELAGSGGLLFTGRLSVPSHPWLADHVVSGSVVVPGTALVELVLRAADEVGCGAVEE
LTLAAPLVLPASGSGVQVQVWLGQPDGTGRRSASVHAREADGPWTLHAGGAVTSGAEAVP
FDVVEWPPRGAEQLDVADCYDALADAGLTYGPVFRGLRAAWKLDHDVYAEVSLPEGTDGR
AYGLHPALFDAALHAAAASGGVEAGAVPFSWTGVALHASGAGHLRVRIRGTANGMSVVMA
DTSGAPVASVESLVVRPLPTGRLQAADRDALFTVDWVPVPLTEERVELGTDPVVEPSQIP
ADLPALSGPTAPGTVLVAPSTDTTGLVESVHRTAAWALETVQSWLAEERFASSRLVFVTR
GAVSGADLAGAAVWGLVRSAQSEHPGRFGLVDLDDGADVTALTRALATDEPELLLRGDEV
LAPRLARAEAQQDRRWNPSGPVLITGGTGGLGRAVARHLVTEHGVRNVLLVSRRGPAADG
AGEFVDELARLGAEAVVEACDVADAVSVADLVERHVPSAVVHTAGVLDDGVVESLTAQRL
AAVLRPKVDAAWHLHEATKGLDLDAFVVFSSVAGTIGSPGQGNYAAGNAFLDALVRHRRA
AGLPAVSLAWGPWSQDSGMTGALTEADFQRMARQGMPPLSVEEGLALFDAALASAEAAPL
PVRLDLAALRAQGEPQPLFRGLIRTRNRRSGSAAASGIVRRLAGLSTAERHEALLDVVRA
QIAAVLGHASPATVDPERAFQDLGLDSLTAIELRNLLGKATGLRLPATAVFDYPTAGALA
NHLLGELFGTETETETPIPVSALPPLTDDPVVIVGMSCRFPGGVTSPEDLWRLVSEGVDA
VSDFPTDRGWEIDDTYDPDREGAIATRSGGFLHDAAEFDPEFFGMSPREALTTDAQQRLL
LETTWEALERAGMDPATLRGSRTGVFAGVMYHDYSTLLSGREFEGYQGSGSAGSVASGRV
SYTFGFEGPAVTVDTACSSSLVALHLAAQSLRLGECSLALAGGVTVMSTPATFVEFSRQG
GLSADGRCKAFADAADGVGWAEGAGILVLERLSDARRNGHRILATVRGSAVNQDGASNGL
TAPNGPSQQRVIRQALASAGLSASDVDAVEAHGTGTTLGDPIEAQALLATYGQGRPEDRP
LRLGSVKSNIGHAQAAAGVAGVIKMVLAMRHGVLPRTLHVDDPSTHVDWNAGAVELLTSP
VAWEQGDGPRRAGVSSFGISGTNAHVILEQPEPVPTDTPAGTEAGPEGAEDETAEAGTPV
PVPVPLSGRTEPALRAQAARLLSRLDSGPGQRVTDVAYSLATGRSAFPHRAVILAADRKG
LLRALSALAEGRSEAAVVVQDRARTGKLAFFFSGQGSQRLGMGRELYGRYPVFAAAFDAV
CAALDEHLERPVRDVVWGEDAEALNQTAYAQAGLFAIEVALYRLLESWGVRPDQLLGHSV
GELAVAHVAGVLSLPDAGALVAARGRLMQALPAGGAMVAIRATEQEVLPHLSEKASIAAV
NGPASVVVSGAEDAVLAIAAHFEAEGRKTSRLRVSHAFHSPLMEPMLDDFRAVADRMTYH
APQLPVVSNVTGEPATAEQLCSAEYWVRHVREAVRFADGVGALEAQGVSVCVELGPDGAL
AALATESTGDDAVLTPVLRKDRPEAPALLTAVARLHARGVPVDWSAVFAGTGARWVDLPT
YAFQRERFWPSTRVVRSGDVRFAGLESAEHPLLGAAVELAGSDGLLFTGRLSVATHPWLA
DHVVQGAVLVPGTALVELVLRAADEVDCGAVEELTLAAPLVLPSADGAVQVQVRVGEPEN
GGHRPVSVHARSGAEPWTLHASGALAPAAEPPSFDAAAWPPEGAEPLDVTDCYERFADAG
FGYGPVFQGLRAAWRAGDDVYAEVGLPEGTDGAAYGLHPALFDAALHAALLDGEGADEKG
VPFSWSGVSLHASGASRVRVRIRATDSGTSIALADPTGAPVASVRTLIARPLTVGQLHGG
DSLYAVDWTGVPLAGEPAGTLALLGKDADGLLDALSLRSHADLGEIAAVGAPDTVLVPTT
TGPAGTVESVHAAAAEALELVQAWLAEERFASSRLVFVTRGAVSGADLAGAAVWGLVRSA
QSEHPGRFGLVDLGDAAEVALVPQALASDEPQLLVRGEQVGAARLARMARPDSPAAGVEW
NGSGPVLITGGTGGLGRAVARHLVTEHGVRNVLLVSRRGPAADGAGEFVDELARLGAEAV
VEACDAADAVSVADLVERHVPSAVVHTAGVLDDGVVESLTAQRLAAVLRPKVDAAWHLHA
ATRHLDLDAFVVFSSVAGTVGSPGQGNYAAGNAFLDALAHHRRGLGLPGASLAWGPWSQD
SGMTGALTDADVERMVRQGMPPLSVEEGLALFDAALASAEAAPLPVRLDLAALRAQGEPQ
PLFRGLIRTPGRRTAAAPAAAAAFARRLTGLSAAEGRELVLDAVGGQVATVLGHSKGTEL
DPDRAFLDIGFDSLTAVELRNGLSALTGIRLPATLLFDYPTPAELVDHLHARLAPEPAAG
PEALLGELERLEKTFGGLDVTEEVHEQIAGRLEVLRAKWDALRDTPAAAGPGDSRSDQDF
DFESASDEEVFDLLDNEFGLS
NT seq 20406 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaggagaagctgcgcgagtacctcaagcgcgcgatcgcagaccttcacgag
actcgtcagcaattggacgagaccgaggcgaagcagcgcgagccgatcgcgatcgtctcg
atggcctgccgcttccccggaggcgtccgcgcgccggaagagctctgggcgctgctgcgc
gacggggtcgacgcgatctcctccttcccccgcaaccgcggctgggacctggaagcgctc
ttccaccccgacccggcccaccagggcaccgcctacgcgcgcgagggcggattcctccac
gaggcgggcgagttcgaccccgccttcttcgggatctccccgcgcgaggcgctcgccatg
gacccccagcagcgactgctgctggaaaccgcctgggaggccgtcgaacacgccggcatc
gacccgcagtccctcgcgggcagccagaccggcgtcttcgtcggcaccggccacggcggg
tacgacgccgaagggggccgacgcgccgacgaggtcggcggacacctgctgaccggcaac
cacatcagtatcgcctccggccggatctcctacgtcctgggcctcgaaggccctgcactg
accgtggacacggcctgctcatcgtcgctggtcgccctgcacctggccatgcacgcgctg
cgacgcggcgagtgcgccatggccctggtgggcggcgcgaccgtgatgtccacaccgcag
atgttcgtggagttctcccgccagcgcggcctggcccccgacggccgctgcaagccgttc
gcggccgccgccgacggcacgggctggagcgagggtgtcgggctgctggtggtggagcgg
ctcagcgacgccgtgcgcaacggtcatcccgtgctcgccgtgctgaagggctcggccgtc
aaccaggacggcgcctccaacggcctgaccgcccccaacggcccctcccaacaacgcgtc
atacgccaggcactggccggcgcgggcctggccgcctcggacatcgacgcggtggaggcg
cacggcaccggcaccaccctcggcgaccccgtcgaggcgcacgccctgctggccacctac
gggcagcagcgccccgcggaccggcccgtgttgatcggctccatgaagtccaacatcggg
cacacccaggccgccgccggtatcgccggcgtgatgaagatggtcctggcgatgcggcac
gggcaactgcccaggaccctccacctggacgcgcccaccggacacgtcgactggagcgag
ggcaccgccaggctcctcgccgagcccgagccgtggccgagcaccgatcggccccgccgc
gccgccgtctcctcgttcggcatcagcggcaccaacgcccatgtgatcctggaacaggca
cccgcccacgcggccgaacccgctgccgagcaggccgcccgatccggcgcgctgccctgg
atcctgtccgcccgcaccgaagcggccctgcgcgcccaggccgaacgcctcagccgccac
gtgcgcgaccgcgccggcctcgaaccaaccgccgtggcccacgccctcgtggacacccgg
gccctcatggagcacagggcggtcgtcgtcgccgacgaccgcgacgcgctcgtcgagggt
ctggacgcgctggcggccggccgcggtgcgaccggcctggtcagcggcgtcgccgccaag
accaccactgcgttcctcttcgccggacagggctcccagcgcctgggcatgggccgcgaa
ctgcacgccgcgcaccccgagttcgcgtcggccttcgacgcggtgtgcgccgagctcgac
ccgcacctggatcggccgctgcgcgacgtggtcttcgccgacgaaggcagcgccgacgcg
gccctcctcgaccggaccgcctacacccaggccgccctcttcgcactggaaaccgccctg
ttccggctcgtcgaatcctggggcgtggcgccccggttcgtcgccggccactccatcggc
gagctcgccgccgcccacgtcagcggcgtgctgaccctcgaagacgccgcgcggctggtc
gccgcgcggggcaccctgatgcaggcactgcccgaaggtggtgccatggtggcgatccag
gccaccgaggaggagatccgggacagcctcgcgggccacgaggcgcacgtctccctcgcc
gccgccaacgggcccgactccaccgtcatctcgggcgacgaacaggccgtgaccgagatc
gcggcccactgggcggaccacggccgccgcaccaaacgcctgcgggtcagccacgccttc
cactccccgcacatggacgccatgctggaggacttccggtccgtcgcccgcgacctgacc
ttccacgccccccgcatccccgtggtgtccacggtcaccggcgagctcgccaccgaggac
gaactgcgctcgcccgactactgggtccggcaggtccgcgaagcggtccgcttctgcgcc
gccgtgcgcaccctcgaagccgagggcgtcaccaccttcgtggagatcggcccggacggc
gtcctcacccccatggtccaggactgcctgaccaccctcgacgggccggtcccccctgtc
ctcgtccccctcctgcgcgccggccgcccggaggacttcaccctcaccacgggcatcgcc
accgccttcgcacacggcgcgcacgtcgactgggccggctgcctgggcacccgcaacgca
ccccacgtcgcactgcccacctacgccttccagcggcagtggtactggctggacccggcc
gaccccgagccggcggaagcagccaccgccgtggcgggcgaggccggattctgggccgcc
gtcgaacgcgaggacctccaggagctgtcggccgtcctcgccatcgacggcagcgacgcg
gactccctcggcaacctcctgcccaccctgtcctcctggcaccgacggcgccgcatccag
gccaccgcggaccgcctcggctaccacacccactgggccccgcgcaccgtcaccgacaac
cctgccgccgcgggacactggctcgtcgtcctgccccacggccgcgccgacgacccgtgg
accgtccgcctgctggacgccctgcgcgaccagggcctgcacaccgacgtcagggaactc
cccgacaccgacgaacccggtgacgccctcgcccggaccgacacccccttcgacggcgtg
ctctccctgctggccctcgacgaacgggcccacccgcacctgcccgccctaccccggggc
gtggccgccacggccggcctgctgcgcgccctggagaccgcgggcatccaggcaccgttg
tggtgcctgacccgcggcgccgtcgcagtcgaccggcacgaggccctcaccagccccgta
caggcccagacctggggcctgggccgggtggccgcgctggagtccccgcagacctggggc
gggctcgtcgacctccccgaaaacccggacgggcgggccgtcgccgcgctgctgcgcacc
ctcgcgggggaggaggaccaggtcgcgatccgcccgaccggggtcttcacccgccgcctg
gaacgggtcgcccccggggacaccgacgccccgtggcacgcccacggcaccgttctggtc
accggcggcaccggtgccctcggcacccacctcgcccactggctggccggcgccggcgcc
caacacctggtgctcaccagccgccgcggcccacaggctcccggcgcaccggaactcgcg
gccgcactcaccgaccgcggcgtcgaggtcaccctcgccgcctgcgacgccgccgaccgc
gacgccctggcggccgtcctcgccgacatcccggcccacctgccgctcaccggcgtcgtc
cacgccgcgggcgtgctggacgacggcgtgctcgacgcgctcacccccgagcgcttcgag
accgtgctgcgccccaaggcgcaggcggcgcggaacctgcacgaactcacccaggacctg
gacttggaccacttcgtgctgttctcctcgatcgtcggtgtcctgggcaaccccggccag
gccaactacgccgccgccaacgcctacttggacgccctcgccgaacaacgccaccggcag
ggcctcccggccacctccgtctcctggggcccctgggcgggcgacggcatggccaccgac
agcgacgccgccgaccggatgagccgcgacggactgctgcccctgcccgcggcccccgcg
ctcgccgccctgcgccaggccctcgcccagggcatgacacacgtgaccgtggcggacatc
gactggagcgcctacgcccccgccctgaccgccgtccgccccagccccctcatcgcagac
ctgcccgaggcgcgccgcgccatccgccccgcggacggcccgcgccggggagcctccccg
ctgcgcgagcggatcggcgcactgccgcccgccgaacaggaacaggcgttcctggcgatg
gtcagggaggaggccgccaaggtcctcggccacccctcaccggacaccgtcgacgtccaa
cgcgccttccgcgagcagggattcgactccctgatggcagtcgacctgcgcaaccggctc
tccgccgcgacgggcctgcggctgcccaccaccctgctgttcgaccatccctcttccgtc
gcggtcgccgcatacctgcgcgccgaggtcctcggtgccgcaggtcccgccacggtcgtg
caggcgtcggccgccgccctcgacgagccggtggcgatcgtcggcatggcctgccgcttc
cccggcggcgtggactcacccgcggccctgtggcggctcctggccgagggcggcgacgcg
atcacccccatgcccaccgaccggggctgggacctggaccgcctctaccactccgacccc
gaccaccagggcaccacctacgcccgcggcggcggcttcctggacggtgtggccggcttc
gacgccgacttcttcggcatctcgccgcgcgaggccctcgcgatggacccgcagcagcgg
ctgctgctggaaaccacctgggaggtgctcgaacaggcgggcatcgacccggagtccctc
cgtggcagcagcaccggggtcttcgcgggcaccaacacccaggactacggcgccgtgttg
gacaccgcacaggacgaagcgggcgggcaccggctcaccggcaacgccctgagcgtcgtc
tccggccgcgtctcctacaccttcggtttcgaagggccggccgtgacggtggacaccgcg
tgctcctcctcgctggtggccctgcacatggcggcgcaggcgctgcgccagggcgagtgc
tccctggcggtcgccggcggcgtgacggtgatgtccacaccgtcctccttcgtggagttc
gcccggcagcgcggcctggcccccgacggtcgctgcaagccgttcgcgtcggccgccgac
ggcaccggctggagcgagggcgtcggtctgctgctggtggagcggctgtccgacgcccgc
cgcaacggccaccaggtcctcgccgtcgtccgcggctcggccgtcaaccaggacggcgcc
tccaacggcctgagcgcacccagcggcccctcccagcagcgggtgatccgacaggccctg
gccaacgcccagctggccgcctccgaagtcgacgcagtggaggcgcacggcaccggcacg
acgctcggcgacccgatcgaggcccaggcactgctggccacctacggccaggagcacccg
ccggagcagccgttgctgctgggcgcggtgaagtccaacctcggacacacccaggccgcc
gccggtgtggcgggcgtgatgaagatggtgctggcgatgcggcacggaatgttgccgcgc
accctgcacgtcgacgaacccaccgggcacgtcgactggaccgccggcgcggtcgaactg
ctcaccgagaacaccgactggcccgacaccggccacccgcgccgcgccgccgtctccgcg
ttcggcatcagcggtaccaacgcccacgtggtcctggaactgcccgcggccaccgaaccc
gaagcgcccgccaccccggtcgggacggtaccgctgctgctctccgccaagagcgggagc
gccttgcgcgcccaggcggcccgactccactcccacctcgaccgcgagcccgcgctgcgg
ctcgccgacgtcgcgcacgcgctgatcactcgccgcacggccttcgcccaccgcgcgacc
gtccgcgccgacgaccacgccaccgcgctgcgggccctgaccgcactcgccgccggcgag
gccgaccccgccctggacaccggcacggcccacaccggccgggacgccgtcctcttctcg
ggtcaggggtcccaacgcctgggcatgggacgcgagttgtacgccggacatccggtcttc
gcggcggcgttcgacgcggtctgcgccgccctggacgagcacctggaccgccccctgcgg
gacgtggtgtggggcgaggacgcggatgagttgaaccggacggtctacgcccaggccggg
ctgttcgccctcgaggtggccctgttccggctcgtggagtcctggggcgtcagcccgcag
tacgtggccggacactccgtcggcgagatcgccgccgcgcacgtcgccggggtgttctcc
ctggccgatgcctgcgcgctggtggcggcgcgcggaaggctgatgcaggcgctgcccgcc
ggcggcgcgatggtggcgctgcaggccaccgaggaggaggtgctgccgcacctgaccgac
gacgtcgcgctcgccgccgtgaacggcccccgggccaccgtggtctccggcaccgaggcc
gcggtgctcgcgctcgccgcgcacttcgaggccgagggccgcaagaccacccggctgcgg
gtctcgcacgccttccactcgccgctgatggaaccgatgctggacgacttccgcgcggtc
gccgagggcctgtcctacggcgagccggaacggtccgtcgtctcgaacgtgaccggcgaa
ctcgccaccgaggaccgactgcgcacccccgagtactgggtgacccacgtgcgcgccgcg
gtgcgcttcgccgacggcatccgcaccctgcacgcgcagggcgtgacgcgcttcctggag
ctgggccccgacggcaccctcacggccatggcccgcgagtcgctgccggacgacggcgcc
accgaccgcagcgcccccgacgagggcgttctcgcccccgccctgcgccgggaccgcccc
gaagaggcgaccctgctcgctgccctgacgcagctgcacgtgagcggggccgagatcgac
tggacatcgttccccgccgcccgggacgcgcgccccgtcgacctgccgacgtacgccttc
cagcaccagcggttctggccgacccccgaccacacccgcaccggggacatcggcgccgtc
ggcctcgaagcggccgggcaccccctgctgagcgccgccgtggaactgcccgacggcgac
ggtgtgctgttcaccacgcgcctgtcgctcgccacccacccgtggctggccgggcacgcc
atcatgggctcggtcctgctgccgggcacggcattcgtcgaactcgcggtccgcgccgcc
gacgaggccggctgcgaacgcgtcgaggaactgacgctggccgccccgctgatccttccc
gagcacggcggcgtacacctccaactgcatgtgggtcccgccgacgaagcgggccgccgc
acgttcagcgcgcgttccagggccgagggcgacggcgaccacccgtgggtgcagcacgcc
accggtgtactcgccgtcgacccgcagccggccgccaccgacgtcgacctcgccgcgatg
ccctggccgcccgccgacgccgagcccgtcgagctgaccgacttctatccccgcctggcc
gaccgcggattcgactacggcccgcacttccagggcctgcgcgccgcatggcgccgtggc
gacgaggtcttcgccgatgtcgccctgcccgtcgcggccgagggcgaagcaccggcctac
ggcctgcacccggcactgctggacgcggccctgcacatcgtgaccttcaacggcatcgag
caggacgtcgtcccgttcgcctgggaaaacgtctcgctgcacgcctccggcgccgcggcg
gtacgggtccgggtcacccggcacggcaacgacacggtgtccgtggacgtcgccgacacc
acgggcgagcccgtcgccaccatcggtgccctcgtcctgcggacggtctccgccgaccag
tggcacagcggcacggctccgatcggccgcgacgcgctgttccgcctccggtgggacccc
gtgcgcctgcccccggtcgacgccgtggagaccgtcgcggcggtcggtctcgccaccgac
ccggccgccggatggtcgaccgagctgatcgagcactacgccgacctggacgcccttgcc
gcagccggccgagctcccggtgcggtgctcacgccggtgacgaccgacctcgacggaccc
ggcacggtcgaggcggtccacgccgcgaccgcgcggacgctggcggcgatgcagtcgtgg
ttggcggacgaccggttcgcgtcctcgcgtctggtgttcgtcacgcggggcgcggtgtcc
ggtgcggatctcgcgggcgccgcggtgtggggtctggtgcggtcggcgcagtcggagaac
ccgggccgcttcggtctggtggatctggacaccgacgccgaaacggacctgctccccatg
gcgttggcctcggacgagccgcagttgtcgctgcggggcggcgaggtgctggtcccgcga
ctggcccgtgcccaggcgcagcggaagcatgtctgggacaccgccggcacggtgctgatc
accggtggtacgggtggtctgggacgtacggtggcgcggcacctggtggtcgagcacggg
gtgcggagcctgttgttggtgagccgtcgtggccgggccgcggaaggggccggggaactg
gtcgccgaactggcggagcacggtgcacaggtcgtcgtggaggcatgtgacgtcaccgac
gcggccgccgtgcaggacctgatcagccgtcatgttccttcggtcgtggtgcatacggcc
ggtgtgctggacgacggcgtggtggggacgttgacgccggagcggttggccgcggtgctg
cgtccgaaggtggacgcggcgtggcacctgcacgaggcgaccaaggacctggacctggac
gccttcgtggtgttctcgtccgtggcgggtgcgatcggcagccccggccaggccaactac
gccgcgggcaactccttcctggacggcctggcgcaccaccgtcgtgcggcgggtctgccc
gcggtgtcgatggcgtgggggccctggtcccaggacagcggtatgaccggcaccctcacc
gacgccgacctgcagcgcatcgcccgccagggcatgccgccgctctccgtcgagcagggc
gtggccctcttcgacgccgcactggcggccggggacgcccacatgctgcccgtccgcttc
gacctcgcgggcctgcgtgagcagggcgcggtgccgccactcctgcgcggcctgatcagg
acccgcacccggcgctcggtggtggccggctccgccgcggtcgccggcctggtggggcgc
ctgtccgcactgggcgcggcggagcggcgcgaggcgctgctggacctggtacgcgcccag
atcgccgtggtcctgggccacgcgaaccccgagaccatcgacccggaccgggccttcaac
gacctcggcttcgactcgctgaccggcgtcgagctgcgcaaccggctcaacgacgccacc
ggcatgctcctctcgtccaccgccgtcttcgactaccccaccgccggcacgctcgtcggc
ttcctgctggacgagttgttcgactccccggaggaggcccacgcgccgacggtgccgtca
ccgacgggggcggcggacgacccggtggtgatcgtcggcatgagctgccgctacccgggc
ggcgtggcctcccccgaggacctgtggcgactggtgtccgacggcgcggacgcggtgtcc
gacttccccaccgaccgtggctgggacctggaggccctccacaacccggaccccgaggcg
ttcggcacctcgtacacccgctccgggggcttcctccacgaggccccggagttcgacccc
gagttcttcggcatgagcccccgggaagcactggcgacggactcgcagcagcggctgctg
ctggaaacgacctgggaggccatcgagcggacgggcatcgacccgacgtcgctgcggggc
agccggaccggtgtcttcgccggcgtgatgtacaccgactacgaagacctcctcggcggt
gaccagttcgagggcttccgcagcaacggcagcgcggccagcatcgcctccggccgcgtc
tcctacaccttcggtttcgagggtccggcggtcacggtcgacacggcgtgctcgtcgtcg
ctggtggcactgcacctggcggcgcaggcactgcgggcgggggagtgctcgctggcgctc
gccggtggcgtgacggtgatgtccaccccgacgacgttcgtggagttctcacgccagcgc
ggactggcggcggacgggcgctgcaaggcgttctccgacgcggccgacggtgtcgggtgg
ggcgagggcgtgggcatgctcgtgctggagcgcctgtcggatgcgcgccgcctcgggcac
cgggtgctggccgtggtgcgtggctcggcggtgaaccaggacggcgcgtcgaacggtctg
acggcgccgaacggcccgtcgcagcagcgggtgatccgccaggcgttggccagtgcggga
gtgtccgcggcggacgtggacgcggtcgaggcgcacggtaccggcacgacgctgggcgac
ccgatcgaggcccaggcactgctggccacctacggccgggaacggccggacgaccggccg
ctgctgctgggcaccgtcaagtccaacatcgggcacgcgcaggcggcctcgggtgtcgcc
ggtgtcatcaagatggtgctggcgatgcgccacggcgtcctgccccggacgctgcacgtc
gacgagccgtcgacgcacgtggactggagcgccggcgccgtggaactgctgacgtccgag
acggagtggccgcagggcacgggtccgcgccgcgcgggcgtctcctccttcggagtcagc
gggacgaacgcgcacgtcatcctggagcagcccgaaccgatcgcggacgacgccgtaccg
gacgcggtcgaggacgagcccggcgcgctggcgtgggtgctctccggccggagcgagtcc
gccctgcgcggccaggcggcccgcctcctgcccctcgtcgccggccgcgacgcgcggtcc
gcgcgggacatcggccactcactggtgaccggacggacgcgcttcccccaccgcgcggtg
gtgtggggccaggaccgcgacgccctggtgctcgccctgtccgcactcgcggtgggcgag
acctacaccggtctggcggagggcacctccgacgccgggaagaccgccttcctgttctcg
ggtcagggctctcaacgcctgggcatggggcgggagttgtacggtcgctatccggtcttc
gcggcggcgttcgacgcggtctgcgccgccttggacgagcacctggagcgccctgtgcgg
gacgtggtgtggggcgaggacgcggaggcgctgaaccagaccgcgtacgcccaggccggg
ctgttcgcgatcgaggtggcgctgtaccggctggcggaatcgtggggcgtacgcgccgac
ttcgtgacgggccattcgatcggtgaggtcgccgcggcgcatgtggcgggtgtcttgtcg
ctcccggacgcgggtgcgttggtggcggcccggggccggctgatgcaggcgctgccggcc
ggcgggacgatggtggcgctcagggcgacggaggaggaggtcctgccgcacctgaccggc
gaggtgtcgatcgcggcggtcaacggcccgtcgtcggtggtggtctccggtgcgcaggac
gcggtgctggccgttgcggcgcacttcgaagcggagggccgcaagaccacgcgactccgg
gtctcgcacgccttccactcgccgctgatggaaccgatgctggacgacttccgcgcggtg
gtggcacgactgtccctcggcacgccgacgatccccgtcgtctcgaacctgacgggccgg
ctcgccgagcccgaacacctctgccgggccgactactgggtccggcacgtccgcgaagca
gtgcgcttcgcggacggcgtcgagacgctgcacgccgcaggggtgacgcggttcctcgaa
ctcggcccggacggcgtcctgtcggccatggcccgggagtcgctgccggacgaggccgtg
ctcgctcccgtactgcgcaagaaccggcccgaggagacgacgctgctcggtgccctggca
cagctgtacgtccggggcggagatgtggactgggcgtcgctgtacgccggtaagggtgcg
cggtgggtggacctgccgacgtacgcgttccagcgcgagcggttctggccgtcgaccaga
gtggtgcgctcgggtgacgtgcggttcgcgggtctggactccgcggagcatccgttgctc
ggtgcggcggtcgaactggccgggtccggcgggctgttgttcaccggtcggctgtcggtg
ccgtcgcatccgtggttggcggatcatgtggtgtcggggtccgtggtggtgcctggtacg
gcgctggtggaactggtgctgcgggcggccgacgaggtgggctgcggtgcggtggaggag
ctgacgctcgccgccccgctggtgctgcccgcttcgggcagcggagtgcaggtgcaggtg
tggctgggacagcccgacggcacgggccgtcgctcggcctcggtgcatgcacgcgaggcc
gacgggccctggacactgcacgccggcggagcggtgacctcgggcgccgaagcggtcccc
ttcgacgtcgtggaatggcccccgcggggcgcggagcagctggacgtggcggactgctac
gacgcactggccgacgcgggactcacctacggcccggtgttccggggcctgcgcgcggcc
tggaagctcgaccacgacgtctacgccgaggtgagccttccggagggcacggacggccgc
gcctacggactccaccccgcgctcttcgacgccgccctgcacgcggcggcggcatcgggc
ggtgtggaagcgggcgcagtccccttctcctggaccggagtcgccctgcacgcctccgga
gccggccacctccgcgtccgcatccggggcacggccaacggcatgtcggtcgtgatggcc
gacacctccggcgcgccggtcgcctccgtcgagtcgctggtggtgcgtccgctcccgacc
gggcggttgcaggcggccgaccgtgacgccctcttcacggtcgactgggtccccgtcccg
ctcacggaggagcgcgtcgaactcggcaccgacccggtggtggagccgtcgcagatccct
gccgacctgccggccctgtcgggcccgaccgcgccgggaacggtcctggtcgccccctcc
accgacaccaccggactcgtggagtccgtccaccgcacggccgcctgggcgttggaaacg
gtgcagtcctggctggcggaggagcggttcgcgtcctcgcgtctggtgttcgtgacgcgg
ggggcggtgtccggtgcggatctcgcgggcgccgcggtgtggggtctggtgcggtcggcg
cagtcggagcacccgggccgcttcggcctggtggacctggacgacggcgccgacgtcacc
gccctgacgcgcgcactcgcgaccgacgagcccgaactcctgctgcgcggcgacgaggtg
ctggccccacggctggcccgtgccgaggcgcaacaggaccgcaggtggaatccgtccggc
ccggtgctgatcacgggtggtaccggtggcctggggcgggccgtcgcccgacacctggtc
accgagcacggggtgcggaacgtgctgctggtcagccggcgcggtccggccgccgacggc
gccggcgagttcgtcgacgaactcgcccggctcggtgcggaggccgtggtcgaggcgtgt
gacgtggcggacgccgtgtccgtggcggatctggtggagcgtcatgtgccgtcggccgtg
gtgcacacggccggtgtgttggacgacggtgtggtggagtcgttgaccgcgcagcggttg
gccgcggtgttgcgtccgaaggtggatgcggcgtggcacctgcacgaggcgaccaagggc
ttggacctggacgcgttcgtggtgttctcctcggtggcgggcaccatcggtagccctggt
caggggaactacgcggcgggcaatgccttcttggacgcgttggtgcgtcaccggcgtgcg
gcgggtctgcctgccgtctcgctggcgtggggtccgtggtcgcaggacagcggcatgacc
ggtgccctcaccgaggccgacttccagcggatggcccgtcagggcatgccgccgttgtcg
gtcgaggaggggttggccctcttcgacgccgcgctcgcgtcggccgaggccgcgccgttg
ccggtccgcctggacctcgcggcgctccgcgcgcagggcgaaccccaaccactgttccgc
ggcctgatccgcacgcggaatcgccgatccggctccgccgcggcatccggcatcgtgcgg
cgcctggccgggctgtccacggcggagcggcacgaggcgctgctcgatgtcgtacgggcc
cagatcgcggcggtcctggggcacgcgagcccggcgacggtcgacccggagcgggccttc
caggacctcggcctcgactccctgaccgccatcgaactccgcaacctgctgggcaaggcc
accggactgcggctcccggcgaccgccgtgttcgactacccgacggccggcgccctggcg
aaccacctcctgggcgaactgttcggcaccgagaccgagaccgagaccccgatcccggtg
tccgctctcccgcccctgaccgacgacccggtggtgatcgtcgggatgagctgccgcttc
cccggcggcgtcacctcgcccgaggacctgtggcggctggtgtcggaaggcgtggacgcc
gtctcggacttccccaccgaccgcggctgggagatcgacgacacctacgaccccgaccga
gaaggcgccatcgccacccgctccggtggattcctccacgacgcggccgagttcgacccc
gagttcttcgggatgagcccccgggaggccctgaccaccgacgcccagcagcggctgctg
ctggagacgacctgggaggcgctggaacgcgccggtatggacccggcgaccctccgcggc
agccgtaccggcgtcttcgccggcgtgatgtaccacgactactcgacgctgctgtccggg
cgcgagttcgagggctaccagggcagcggcagcgcgggcagcgtcgcctcgggccgcgtc
tcctacaccttcggcttcgagggcccggcggtcaccgtcgacacggcctgctcgtcgtcg
ctggtggccctgcacctcgcggcgcagtcgttgcgactgggcgagtgctcgttggcgttg
gcgggtggcgtgacggtgatgtcgacgccggcgacgttcgtggagttctcgcgtcagggc
gggctctccgccgacgggcggtgcaaggcgttcgcggacgcggccgacggtgtcggctgg
gccgaaggcgccggaatcctggtgctggagcgcctgtcggacgcgcgtcgcaacgggcac
cggatcctggcgacggtgcggggcagcgccgtgaaccaggacggcgcgtccaacggtctg
acggcgccgaacggcccgtcgcagcagcgggtgatccggcaggcactggcgagtgcggga
ctgtccgcgtcggacgtggacgccgtcgaggcgcacggtacgggcacgacgctgggcgat
ccgatcgaggcccaggcgttgctggccacgtacggccagggccggccggaggaccgtccg
ttgcggttgggatcggtgaagtccaacatcggtcatgcgcaggcggctgcgggtgtcgcc
ggtgtcatcaagatggtgctggccatgcgccacggcgtgctcccgcggacgttgcacgtg
gacgatccgtcgacgcacgtggactggaacgccggtgcggtcgagctgctgacgtccccg
gtcgcgtgggagcagggggacgggccgcgacgggcgggcgtgtcgtccttcggcatcagc
ggcacgaacgcgcacgtgatcctggaacagcccgaacccgtccccaccgacacccccgcc
ggcaccgaagccggaccggagggcgccgaggacgagacggccgaggccgggacaccggtg
ccggtgccggtgccgctgtcgggccggaccgagccggcgctgcgggcccaggcggcgcgc
ctgctgtcccgactggacagcggtccggggcagcgggtcaccgacgtcgcctactcactg
gcgacgggccgctcggcgttcccacaccgcgcggtgatactggccgcggaccggaagggc
ctgctgcgggccttgtccgccctggcagagggccgcagtgaggcagccgtcgtggtgcag
gaccgggcccgcacgggcaagctcgccttctttttctcgggtcagggctctcaacgcctg
ggtatggggcgggagttgtacggtcgctatccggtcttcgcggcggcgttcgacgcggtc
tgcgccgccttggacgagcacctggagcgccctgtgcgggacgtggtgtggggcgaggac
gcggaggcgctgaaccagaccgcgtacgcccaggccgggctgttcgcgatcgaggtggcg
ctgtaccgcctgctggagtcgtggggcgtgcgccccgaccagctgctggggcactccgta
ggggagctcgccgtggcgcacgtcgcgggtgtcctctccctgccggacgcgggcgcgttg
gtggcggcccggggccggctgatgcaggcgctgccggccggcggggcgatggtggccatc
agggcgaccgagcaggaggtcctgccgcacctgtcggagaaggcgtcgatcgcggcggtc
aacggccccgcgtcggtggtggtctccggagccgaggacgccgtgctcgccatcgcggcg
cacttcgaggccgaggggcgcaagaccagcaggctgcgggtctcgcacgccttccactca
ccgctcatggaaccgatgctggacgacttccgcgccgtcgccgaccgcatgacgtaccac
gcgccgcagctgcccgtggtctcgaacgtcaccggcgagcccgccaccgccgagcaactg
tgctccgcggagtactgggtccggcacgtccgcgaggcggtgcgcttcgcggacggggtc
ggcgcgctggaagcgcagggcgtctcggtgtgcgtggagctcggcccggacggcgccctc
gccgcgctcgccacggagtccaccggggacgacgcggtgctgactccggttctgcgcaag
gaccggccggaggcaccggcgctcctcacggcggtggcgcggctgcacgcccgcggcgtc
cccgtcgactggtccgccgtcttcgccggtacgggtgcgcggtgggtggacctgccgacg
tacgcgttccagcgcgagcggttctggccgtcgaccagagtggtgcgctcgggtgacgtg
cggttcgccggcctggagtccgcggagcatccgctgctcggtgcggcggtcgaactggcc
ggctcggacggcctgttgttcaccggtcggctctcggtggccacgcatccgtggctggcc
gaccacgtggtgcagggggcggtgctggtgcccggcaccgcgctggtggaactggtgctg
cgggcggccgacgaggtggactgcggtgcggtggaggagctgacgctcgccgccccgctg
gtgctgccctcggcggacggcgcggtccaggtgcaggtgcgggtgggcgagcccgagaac
gggggacaccgaccggtgtcggtgcacgctcgttccggagcggagccgtggacgctgcac
gccagcggcgccctggcgccggcagccgagccgccgtcgttcgacgccgcggcctggccc
ccggagggcgccgagccgctcgacgtgacggactgctacgagcggttcgcggacgccggg
ttcgggtacggaccggtgttccagggcctgcgggcggcctggcgggcgggcgatgacgtc
tatgcggaggtcggactcccggagggcaccgacggtgccgcctacggtctgcacccggcg
ctcttcgacgcggcgctgcacgcggcgctcctggatggcgaaggcgccgacgagaagggg
gtccccttctcgtggagcggggtgtccctgcacgcgtccggtgcctcccgggtgcgggtc
cgcatccgtgccaccgacagcggcacgtcgattgcgctcgcggacccgaccggtgccccg
gtggcctcggtgcgcaccctgatcgcccgtccgctcaccgtcggtcagctgcacggcggc
gattccctctacgcggtcgactggaccggcgtacccctcgccggcgagccggcgggcacc
ctcgccctgctcggcaaggacgccgacggcctgctcgacgccctctcgctccggtcccac
gcggacctcggtgagatcgcggccgtcggcgcgcccgacacggtgctggtcccgacgacg
accggccccgccggcacggtggagtcggtccacgccgcggcggcggaggcgctggagttg
gtgcaggcgtggctggcggaggagcggttcgcgtcctcgcgtctggtgttcgtgacgcgg
ggggcggtgtccggtgcggatctcgcgggcgccgcggtgtggggtctggtgcggtcggcg
cagtcggagcacccgggccgcttcggcctggtggacctcggtgacgctgccgaagtggcg
ctcgtaccacaggcgttggcgtcggacgagccacaactgctggtgcgcggcgagcaggtc
ggcgccgcgcggctggcccgcatggcacggccggattcccccgcggccggcgtcgagtgg
aacgggtccggcccggtgctgatcacgggtggtaccggtggtttggggcgggccgtcgcc
cgacacctggtcaccgagcacggggtgcggaacgtgttgctggtgagccggcgcggtccg
gccgccgacggcgccggcgagttcgtcgacgaactcgcccggctcggtgcggaggccgtg
gtcgaggcgtgtgacgcggcggacgccgtgtccgtggcggatctggtggagcgtcatgtg
ccgtcggccgtggtgcacacggccggtgtgttggacgacggtgtggtggagtcgttgacc
gcgcagcggttggccgcggtgttgcgtccgaaggtggatgcggcgtggcacctgcacgcg
gcgaccaggcacctggacctggacgcgttcgtggtgttctcgtccgtggccggcacggtc
ggcagccccggtcaaggcaactacgcggcgggcaacgccttcttggacgcgttggcccac
caccgccgaggtctggggctgcccggagcgtcgttggcgtggggtccgtggtcgcaggac
agcggcatgaccggtgccctcaccgacgccgacgtggagcgcatggtccgtcagggcatg
ccgccgttgtcggtcgaggaggggttggccctcttcgacgccgcgctcgcgtcggccgag
gccgcgccgttgccggtccgcctggacctcgcggcgctccgcgcacagggcgaaccccaa
ccactgttccgcggcctgatccgcaccccgggccgtcgcaccgccgcggccccggccgcg
gcggccgccttcgcacggcggctgaccggcctgtcggcggccgaggggcgtgagctcgtc
ctcgacgccgtgggcggccaggtcgcgaccgttctcggacactccaagggcacggagctc
gacccggaccgcgccttcctggacatcggcttcgactccctgaccgcggtcgaactccgc
aacggcctgagcgccctcaccggaatccgcctgccggcgaccctgctgttcgactacccg
acgccggcggagttggtcgaccacctccacgcccggctcgcacccgagccggccgccggc
ccggaggcactcctgggcgagctcgaacggctggagaagaccttcggcgggctcgacgtc
acggaggaggtccacgagcagatagccggccggctggaggttctcagggcgaagtgggac
gccctccgcgacacccccgcggcagccgggccgggcgactcccggtccgaccaggacttc
gacttcgagtccgcctccgacgaggaggtcttcgacctcctcgacaacgagttcggcctg
agctga

DBGET integrated database retrieval system