KEGG   Sneathia amnii: VC03_00875Help
Entry
VC03_00875        CDS       T03854                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sns  Sneathia amnii
Pathway
sns00010  Glycolysis / Gluconeogenesis
sns00020  Citrate cycle (TCA cycle)
sns00620  Pyruvate metabolism
sns01100  Metabolic pathways
sns01110  Biosynthesis of secondary metabolites
sns01120  Microbial metabolism in diverse environments
sns01130  Biosynthesis of antibiotics
sns01200  Carbon metabolism
Module
sns_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sns00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VC03_00875
   00020 Citrate cycle (TCA cycle)
    VC03_00875
   00620 Pyruvate metabolism
    VC03_00875
Enzymes [BR:sns01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VC03_00875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding AATase CAT
Motif
Other DBs
NCBI-ProteinID: AKC95140
UniProt: A0A0E3ZAV9
LinkDB All DBs
Position
166687..167712
Genome map
AA seq 341 aa AA seqDB search
MEEKLRATPAARSMAKKMQVDLSMISGTGAKGRIHKEDVLVFMENERPRITPLAKKIAEI
NNLDYSTIKGSGFRGKIMKEDVLALMKVEKPVEVKKEKEEVNIAKPVENSNIIPMSAMRK
VIAKRMSESYFLAPTFTLNYEIDMTELKALRAKLIEPIKEKTGLKLTYTDLISMAVIKTL
KKPEHKFVNASLTPDVKNIELHDYVNLSMAVGYDEGLLTPVLKNADKMSLTEIVVGLKDL
AKRALDMKLKPDEMSGSTFTISNIGMYGVDSFNPIINQPNSAILGVCATVDKPVVRDGQI
VIRPMMNLCLTIDHRLVDGLAGAKFMQDLKKLLENPMMMLV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaattaagagctactcctgcagctagaagtatggcaaaaaaaatgcaagta
gatttatcaatgatatcaggaacaggagcaaaggggagaatacataaagaagatgtatta
gtatttatggaaaatgaaagaccaagaataacaccactagcaaaaaagattgcagaaatt
aataatttggattatagtacaataaagggtagtggatttagaggaaagataatgaaagaa
gatgtcttagctttaatgaaggtagaaaaaccagttgaagttaagaaagaaaaagaagaa
gtaaatatagctaaacctgtggaaaatagtaatattattcctatgtcagctatgagaaaa
gttatagccaaaagaatgtcagaaagctatttcctagcaccaacatttacattaaattat
gaaatagatatgacagaactaaaggcattaagagctaaattaatagaaccaataaaggaa
aagacaggcttaaaattaacatatacagatttaatttctatggctgttattaaaacactt
aagaagccagaacacaaatttgttaatgcatcattaacaccagatgtaaaaaatattgaa
ttacatgattatgtaaatctatcaatggcagttggatatgatgaaggtctattaactcca
gtattaaaaaatgctgataaaatgagcttaacagaaatagttgtaggactaaaagattta
gctaaaagagctttagatatgaaactaaaacctgatgaaatgagtggaagtacatttact
attagtaatataggaatgtatggtgtagatagttttaatccaataattaatcaaccaaat
tcagcaattttaggggtttgtgcaacagtggataaacctgttgtaagagatggacaaata
gttatacgacctatgatgaatttatgtttaactatagatcatagattagtagatgggtta
gctggtgctaaattcatgcaagatttgaagaaattattagaaaatccaatgatgatgtta
gtgtaa

DBGET integrated database retrieval system