KEGG   Sneathia amnii: VC03_01795Help
Entry
VC03_01795        CDS       T03854                                 

Definition
(GenBank) hypothetical protein
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
sns  Sneathia amnii
Pathway
sns00500  Starch and sucrose metabolism
sns01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sns00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VC03_01795
Enzymes [BR:sns01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     VC03_01795
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     VC03_01795
    3.2.1.135  neopullulanase
     VC03_01795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_N hDGE_amylase GHL10
Motif
Other DBs
NCBI-ProteinID: AKC95300
UniProt: A0A0E3Z9M8
LinkDB All DBs
Position
371061..372626
Genome map
AA seq 521 aa AA seqDB search
MNKQAILHIQDSNYAYPKSVDKFVVRLRVARNDDIQKVIIEYGCKYTFYDVRFEKEMKIK
YNDELYSYYEVELKLDDPRLAYVFRIYDSSNEMYYYFEEGLSKEFDYKNSFYNYFQYAHI
NEVDIVEEVEWFKNAVFYQIFVDRFNRGKNKKDFSYITMQKEDTPTPHSFYGGDLEGIYD
KIEYLHSIGINAIYLTPIFKSISNHKYDIIDYEKIDEHFGNDEIFINLVKKAHEYGIKIV
IDVVFNHCSNQHNYFNDDKYYDYFRRTKDGYMTFADCEYMPEWNGNNPKVVDYLISITKN
WIRKYDIDGLRLDVADELPHEFWRRFRKEVRNEKNDCIIVGEDWHDSYTYLLGDQFDSAM
NYAFTKACVDYFATQKLDEKGLSDRLNMLLMRYREQNNKQCFNLLDSHDKERFYTQVGKS
KNKLLAGLNLLMFYQGVPCIYYATEQMMEGEGDPYCRRAFDWDKKPEQEILDILKLRKEK
VLVDGDIQIYEKDGKLYVKRTLDDKTKTLVISKNGEEFNVE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaagctatattacacatacaagattcaaattatgcataccctaaatcggtt
gataaatttgttgtaagactaagagtagcaagaaatgatgatattcaaaaagtaattatt
gaatatggttgtaagtacacattctatgatgtgcgttttgaaaaagaaatgaagataaaa
tacaatgatgaattgtattcatactatgaagtagaactaaaattagatgatccaagacta
gcatatgtgtttagaatttatgacagctctaatgaaatgtactactattttgaagaagga
ttaagtaaggagtttgattataagaatagcttctataattatttccaatatgcacatata
aatgaagttgatatagtagaagaagttgaatggtttaagaatgcagtattttatcaaata
tttgtagatagatttaatagaggtaagaataagaaagacttttcatatataactatgcaa
aaggaagatacacctacaccacactcattttatggtggagacttagaaggtatatatgat
aaaattgaatatttacacagtataggaattaatgccatatacctaactccaatatttaag
tctatatcaaatcataaatatgatattattgactatgaaaaaatagatgaacattttggt
aatgatgaaatatttattaatcttgtaaaaaaagctcatgaatatggaataaagatagtt
attgatgttgtatttaatcattgtagcaatcaacacaactactttaatgatgataagtac
tatgactactttagaagaacaaaagatggatatatgacttttgcagactgtgaatatatg
ccagaatggaatggaaataaccctaaagtagtagactacttaataagtattacaaaaaat
tggataagaaaatatgatatagatggtctaagattagacgtggctgatgaattaccacat
gaattttggagacgatttagaaaagaagttagaaatgaaaaaaatgattgtataatagtt
ggagaagactggcatgattcatatacatatttactaggagatcaatttgacagtgctatg
aattatgcgttcactaaagcttgtgtagactattttgcaacacaaaagttagatgaaaag
ggattatcagacagacttaatatgttacttatgagatatagggaacaaaacaacaagcaa
tgctttaatttattagattcacatgataaagaacgtttctatacacaggtaggtaaatca
aagaataagctattagcaggacttaatttattaatgttctatcaaggtgttccttgtatt
tattatgcaactgaacaaatgatggaaggagaaggagatccttactgtagacgtgcattt
gattgggataagaaacctgaacaagaaatactagatatattaaaacttagaaaagaaaaa
gttttagttgatggagatatacaaatttatgaaaaagatggtaaattgtatgtaaaaaga
actttagatgataaaactaaaacattagttatatcaaaaaatggtgaagaatttaatgta
gaataa

DBGET integrated database retrieval system