KEGG   Sneathia amnii: VC03_06205Help
Entry
VC03_06205        CDS       T03854                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sns  Sneathia amnii
Pathway
sns00473  D-Alanine metabolism
sns00550  Peptidoglycan biosynthesis
sns01100  Metabolic pathways
sns01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sns00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VC03_06205
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VC03_06205
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VC03_06205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sns01011]
    VC03_06205
Enzymes [BR:sns01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VC03_06205
Peptidoglycan biosynthesis and degradation proteins [BR:sns01011]
 Precursor biosynthesis
  Amino acid ligase
   VC03_06205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 GARS_A RimK ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AKC96057
UniProt: A0A0E3ZAQ0
LinkDB All DBs
Position
complement(1274254..1275147)
Genome map
AA seq 297 aa AA seqDB search
MRICIIYAGISTEREISIKTAEQIMKSLDKDKYDICELKIDKTEDIFKIKDMNVDLAFIA
LHGKFGEDGRVQAILEAMNIRYTGPGVLASGICMDKDIAKRVLSTYGIRTAKWWTIRKGE
EFTYPKEYEKLIVKPNSGGSSIGVHFISNQQELDEALKDIFTMDDEAIMEEVIEGDEVSV
PIIDGVAYPPIKIEALKGTYFDYTSKYSDGGAREYVTKFSDNLEKELKEFTEKAYYAAKC
KGYSRVDFLVRDDKAYFMEVNTLPGMTATSLLPKSLASVGIGYRETLELLIRASLGE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaatttgcattatttacgctggtatatcaactgaaagagaaatatcaataaaaact
gcagagcaaataatgaaaagtttggataaagataaatatgatatttgtgaattaaaaata
gataaaacagaagatatatttaaaattaaggatatgaatgttgacttagcctttattgca
ctacatggtaaatttggagaagatggaagagtgcaagcaatattagaagcaatgaatatt
agatacacagggcctggagttttagcaagtggtatatgcatggataaagatattgcaaaa
agagtgttaagtacatatggtattagaactgctaagtggtggactattagaaaaggagaa
gagtttacatatccaaaggaatacgaaaagctaatagttaaacctaatagtggtggttca
agtataggtgttcactttatatccaaccaacaagaattagatgaagcattaaaagacata
tttactatggatgatgaagcaataatggaagaagtaatagagggagatgaagtgtctgtc
cctataatagacggtgttgcttatcctcctataaaaatagaggcactaaaaggaacatat
tttgattatacatcaaagtatagtgatggtggtgcaagagaatatgtcacaaaatttagt
gataatttagaaaaagaattaaaagaatttacagaaaaagcatactatgcagcaaagtgt
aagggatattcaagggtagactttttagtgcgtgatgataaggcgtatttcatggaagtt
aatacattaccagggatgacagctacaagtctattaccaaaaagtttagcatcagttgga
ataggttatagggaaacacttgagttgttaataagagcaagtttaggtgaataa

DBGET integrated database retrieval system