KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0892Help
Entry
SPT_0892          CDS       T00875                                 

Definition
(GenBank) alpha-amylase (1,4-alpha-D-glucanglucanohydrolase)
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
snt00500  Starch and sucrose metabolism
snt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPT_0892
Enzymes [BR:snt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SPT_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ACO22550
LinkDB All DBs
Position
complement(837924..839378)
Genome map
AA seq 484 aa AA seqDB search
MQNQTLMQYFEWYLPHDGQHWTRLAENAPHLAHLGISHVWMPPAFKATNEKDVGYGVYDL
FDLGEFNQKGTVRTKYGFKEDYLQAIQALKAQGIQPMADVVLNHKAAADHREAFQVIEVD
PVDRTVELGEPFTINGWTSFTFDGRQDTYNGFHWHWYHFTGTDYDAKRSKSGIYLIQGDN
KGWANEELVDNENGNYDYLMYADLDFKHPEVIQNIYDWADWFMETTGVAGFRLDAVKHID
SFFMRNFIRDMKEKYGDDFYVFGEFWNPDKEANLDYLEKTEEHFDLVDVRLHQNLFEASQ
AGANYDLRGIFTDSLVELKPDKAVTFVDNHDTQRGQALESTVEEWFKPAAYALILLRQDG
LPCVFYGDYYGISGQYAQEDFKEILDRLLAIRKDLAYGEQNDYFDHANCIGWVRSGAENQ
SPIAVLISNDQENSKSMFVGQEWTNQTFVDLLGNHQGQVTIDEEGYGQFPVSARSVSVWA
VNTI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaaacactcatgcaatactttgaatggtatctgccccacgacggtcaacac
tggacgcgtctggctgaaaatgctccacacctagctcatctggggatcagtcacgtctgg
atgccaccagccttcaaggcaaccaacgaaaaagatgtcggctatggggtctatgactta
tttgacttaggagagttcaaccaaaaagggactgtccgcaccaagtatggtttcaaagaa
gactatcttcaagccattcaagcccttaaagcacagggaattcaacctatggccgatgta
gttctcaaccacaaggctgctgccgatcacagggaagcctttcaggtcatcgaagttgat
cctgtagaccgtacagttgaacttggagaacccttcaccatcaatggctggactagtttt
accttcgatggtcgccaagatacctataatggcttccactggcattggtaccacttcact
ggtacagactacgatgccaaacgcagtaaatctgggatttatctgatccaaggggacaac
aagggctgggctaacgaggaattggtcgataacgaaaacggaaactacgactacctcatg
tatgccgacctagactttaaacatcctgaagtcatccaaaacatctatgactgggctgat
tggttcatggaaacgactggtgtagctggtttccgtttggatgccgttaagcatattgac
tctttctttatgcgcaacttcatccgcgatatgaaggaaaaatacggtgacgatttctat
gtttttggtgaattttggaacccagacaaggaagccaatctggactatctcgaaaaaacg
gaagaacactttgaccttgtcgatgttcgtctccaccagaatctctttgaagccagtcaa
gctggcgcaaactatgaccttcgtggcattttcacagatagcctggttgaactcaagcct
gacaaggctgtgacttttgtcgacaaccacgatacccaacgaggacaagcccttgagtct
accgttgaagaatggttcaagccagcagcctatgccctcattttgttacgccaagacggc
cttccatgtgtcttttacggagactactatgggatttcaggccagtatgctcaagaagat
ttcaaagaaatccttgaccgcctcctagccatccgaaaagatttggcctatggagaacaa
aatgactactttgaccatgctaactgtatcggttgggtacgttcaggtgctgaaaatcaa
tccccaatcgcagtccttatctcaaatgaccaagaaaacagcaagtcaatgtttgtcggt
caagaatggactaatcaaacctttgtagatttacttggtaaccaccaaggtcaagttaca
attgatgaggaaggttatggacaattccctgtctcagctagatccgtaagtgtctgggca
gtcaataccatctaa

DBGET integrated database retrieval system