KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_1071Help
Entry
SPT_1071          CDS       T00875                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
snt00240  Pyrimidine metabolism
snt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPT_1071 (tdk)
Enzymes [BR:snt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SPT_1071 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_30
Motif
Other DBs
NCBI-ProteinID: ACO22254
LinkDB All DBs
Position
1013799..1014389
Genome map
AA seq 196 aa AA seqDB search
MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRDGVGYVSSRIGMKRPAL
AIEETTDIFGYIRDLPEKPYCVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLLADKIDEIKTICQYCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVC
RKHYFAPEINKENEEK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttgtattatcgttatgggaccatgaactctggtaaaacgattgagattctc
aaagtggcctataactacgaggagcaaggaaaaggtgttgtcattatgacttcggctctg
gatacgcgtgacggtgttggctatgtgtcgagtcgaattggcatgaaacgccctgccctt
gcgattgaggaaacaacggatatctttggctatatccgagacctaccagaaaaaccttac
tgtgttttggtcgatgaagcccagtttctcaaacgccaccatgtttacgacctagctcgt
gttgtggacgagttagacatacccgtcatggcttttggcttgaaaaatgactttcgcaat
gaattgttcgaaggttccaaatatctcttgcttttagcagacaagattgacgaaatcaag
accatatgtcagtattgcaagaaaaaggcgaccatggtgttgcgaacacaggatggactg
cccgtttacgatggagaacagatccagattggtggtaatgaaacctatatctcggtttgc
cgtaaacattattttgcccctgaaatcaataaggagaatgaagaaaaatga

DBGET integrated database retrieval system