KEGG   Streptococcus pneumoniae Taiwan19F-14 (serotype 19F): SPT_1188Help
Entry
SPT_1188          CDS       T00875                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14 (serotype 19F)
Pathway
snt00010  Glycolysis / Gluconeogenesis
snt00020  Citrate cycle (TCA cycle)
snt00620  Pyruvate metabolism
snt01100  Metabolic pathways
snt01110  Biosynthesis of secondary metabolites
snt01120  Microbial metabolism in diverse environments
snt01130  Biosynthesis of antibiotics
snt01200  Carbon metabolism
Module
snt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:snt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPT_1188
   00020 Citrate cycle (TCA cycle)
    SPT_1188
   00620 Pyruvate metabolism
    SPT_1188
Enzymes [BR:snt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SPT_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: ACO23022
LinkDB All DBs
Position
complement(1134863..1135906)
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAL
EHNIAWQEIQGTGHRGKIMKKDVLALLPENIENDSIKSPAQIEKVEEVPDNVTPYGEIER
IPMTPMRKVIAQRMVESYLTAPTFTLNYKVDMTEMLALRKKVLEPIMEATGKKTTVTDLL
SLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKMSLSELV
VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSSTIEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgacaagctaagagcgactcctgcagctagaaagttagcggatgatttaggg
ataaacctctacgacgtttctggctcaggtgcaaacggtcgtgtccacaaagaagacgtg
gaaacttataaagacacaaacgtggttcgcatttcgccacttgcaaaacgaattgccctc
gaacataacattgcttggcaggaaatccaaggaaccggtcatcgtggtaaaatcatgaag
aaggatgttttggccctgcttcctgaaaatatcgaaaacgatagcatcaaatctcctgct
cagattgaaaaagtggaagaagtccctgataacgtaacaccatatggtgaaatcgagcgt
attccaatgacaccaatgcgtaaggttattgcccaacgcatggttgaatcttacttgact
gcgccaaccttcaccctcaactataaagttgatatgactgaaatgttggctcttcgtaag
aaggttcttgagccaatcatggaagcaactgggaagaagactactgtaacagaccttctt
tcgcttgcagttgttaagactcttatgaaacacccatacatcaacgcttcattgacagaa
gatggcaagactattatcactcacaactatgtcaatcttgccatggcagttgggatggat
aatggattgatgacacctgtcgtttacaatgctgagaaaatgagtctttcagaactggtt
gtagcctttaaggatgttattggccgtaccttggatggtaaattggctccaagtgagtta
caaaattcaacattcacaatcagtaatttgggaatgtttggtgttcagtcctttggtccg
attattaaccaacccaactcagctatccttggtgtcagttcgacaatcgagaagccagtt
gtcgtcaatggtgaaattgtgattcgcccaatcatgagtttaggattaaccattgaccac
cgtgtcgtagatggtatggctggtgctaagtttatgaaggacttgaaagagttgattgaa
acgccaatctcaatgttaatttaa

DBGET integrated database retrieval system