KEGG   Streptococcus pneumoniae Taiwan19F-14 (serotype 19F): SPT_2203Help
Entry
SPT_2203          CDS       T00875                                 

Gene name
hslO
Definition
(GenBank) chaperonin HslO
  KO
K04083  molecular chaperone Hsp33
Organism
snt  Streptococcus pneumoniae Taiwan19F-14 (serotype 19F)
Brite
KEGG Orthology (KO) [BR:snt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:snt03110]
    SPT_2203 (hslO)
Chaperones and folding catalysts [BR:snt03110]
 Heat shock proteins
  HSP33
   SPT_2203 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 zinc_ribbon_4 Elf1
Motif
Other DBs
NCBI-ProteinID: ACO24124
UniProt: C1CUA5
LinkDB All DBs
Position
2056289..2057161
Genome map
AA seq 290 aa AA seqDB search
MDKIIKTISESGAFRAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNT
KLTVKVLGSSSLGAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITD
YGTGNPYNSITPLISGEIGEDLAFYLTESQQTPSAVGLNVLLDEEDKVKVAGGFLVQVLP
GAKKEEIARFEKRIQEMPAISTLLESDDHIEALLKAIYGDEAYKRLSEEEIRFQCDCSHE
RFMNALASLPSSDLQEMKEEDHGAEITCQFCQTTYNFDEKDLEELIRDKS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattattaaaactatatcagaaagcggagcctttcgtgcttttgtccttgat
agcactgaaaccgtccgcactgctcaagaaaaacatcaaacccaagctagctcaactgta
gcgcttggtcgaactcttatcgctagccagattctcgcagccaatgaaaaaggaaatacc
aaacttacagttaaggtgttgggatctagctctctaggtgctattatcaccgtcgctgat
accaaggggaacgtcaaaggctatgttcaaaatcctggtgttgacatcaaaaagactgcg
actggtgaagtcctagtcggaccttttgttggaaatggtcaattcctcgttatcacagac
tacggtactggaaatccttacaactctataactcccctcatctctggagaaatcggtgaa
gaccttgccttttaccttactgaaagccaacaaacgccttcagcggtcggcctcaatgtc
cttttggacgaggaagacaaggtcaaggttgcaggtggtttcctagttcaagtcttgcca
ggagccaagaaagaagagattgctcgctttgaaaaacgcatccaagaaatgccagctatc
tctactcttctcgaaagcgacgaccatatcgaagccctcctcaaggctatctacggggac
gaagcctacaagcgtctttctgaagaagaaatccgtttccaatgtgactgtagccatgaa
cgctttatgaacgctcttgccagccttccaagctcagacttacaggaaatgaaagaggaa
gaccacggtgcagaaatcacttgtcaattctgccaaactacttacaactttgatgaaaag
gacctggaggaactcattcgtgacaaatcttaa

DBGET integrated database retrieval system