KEGG   Streptococcus pneumoniae SPNA45 (serotype 3): SPNA45_00187Help
Entry
SPNA45_00187      CDS       T02245                                 

Definition
(GenBank) putative hexulose-6-phosphate isomerase (pseudogene)
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
snu  Streptococcus pneumoniae SPNA45 (serotype 3)
Pathway
snu00040  Pentose and glucuronate interconversions
snu00053  Ascorbate and aldarate metabolism
snu01100  Metabolic pathways
snu01120  Microbial metabolism in diverse environments
Module
snu_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:snu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPNA45_00187
   00053 Ascorbate and aldarate metabolism
    SPNA45_00187
Enzymes [BR:snu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     SPNA45_00187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 HTH_Tnp_1 NAGidase
Motif
Other DBs
NCBI-ProteinID: CCM07477
LinkDB All DBs
Position
191509..192372
Genome map
AA seq 287 aa AA seqDB search
MVRPIGIYEKATPTHFTWLERLNFAKELGFDFVEMSIDERDERLARLDWSKEERLEVVKA
IYETGVRIPSICFSGHRRYPLGSKDPVLEEKSLELMKKCIELAQDLGVRTIQLAGYDVYY
EEKSPQTRQRFIKNLRKACDWAEEAQVVLAIEIMDDPFINSIEKYLAIEKEIDSPFLFVY
PDIGNVSAWHNDIYSEFYLGHHAIAALHLKDTYAVTESSRGQFRDVPFGQGCVKWEEAFD
ILRETNYNGPFLIEMWSENCETVEETRAAIQEAQAFLYPLIKKAGLM
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtccaattggaatttatgaaaaggcaaccccaacacactttacttggctagaa
cgtttaaattttgccaaggagttaggctttgattttgtcgagatgtctattgacgaacgt
gacgagcgtttagcaagacttgactggagtaaggaagaacgcttggaagttgtcaaagca
atctatgaaactggtgttcgtattccttctatctgtttttcaggccatcgtcgctaccca
ttgggttcaaaagatccagttctagaggaaaaatctctagaactcatgaaaaaatgtatc
gaattagctcaagacttgggagttcgtacgattcaattagctggttacgatgtttactat
gaggaaaagtcaccccagacacgccaacgttttatcaaaaatttgagaaaagcctgtgac
tgggctgaagaagctcaggtggtacttgctattgaaattatggatgatcctttcatcaat
agcatcgaaaaatatttggctatagaaaaagagattgactctcccttcctctttgtatat
ccagatattggtaatgtgtctgcatggcataatgatatctatagtgagttttatcttggt
catcatgccatcgcagctctccatctcaaggatacttatgcagtgacagaaagttcaagg
ggccagttccgagatgtacctttcgggcaaggttgtgtcaaatgggaagaagctttcgat
attttaagggaaaccaattataatggacctttcctaatcgaaatgtggtctgaaaattgt
gaaacagtagaagaaacacgcgcagccattcaagaggcgcaagctttcctctatccactc
attaagaaagcaggtttgatgtaa

DBGET integrated database retrieval system