KEGG   Streptococcus pneumoniae SPNA45 (serotype 3): SPNA45_00777Help
Entry
SPNA45_00777      CDS       T02245                                 

Definition
(GenBank) putative restriction endonuclease (pseudogene)
Organism
snu  Streptococcus pneumoniae SPNA45 (serotype 3)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI Omptin
Motif
Other DBs
NCBI-ProteinID: CCM08063
LinkDB All DBs
Position
complement(join(773476..773850,773854..774033))
Genome map
AA seq 184 aa AA seqDB search
MANDNKSHYLIYRVLGISFEEGENIDLYQNKGRFLYKYAGSFLEEAAVLCFNEKFGTENT
KVNIPNSESTKPKTFEIDCLVGEKHAYEIKWWDATTDGDHITKEHTRIKVIHNKGYIPIR
LMFYYPNRTQAIKIQQTLETLYNGIGGKYYYGDSAWEHLRAVTGIDLLSILTDIANKKTG
VKSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgataataagagccattatttgatatacagagttttaggtatttcatttgaa
gaaggagaaaatatcgatttgtatcaaaataaaggtcgttttttatacaaatatgctggt
tcatttttagaagaagctgcagtactatgctttaacgaaaaatttggtacagaaaatact
aaagttaacattcctaattctgaaagtacaaaacctaagacttttgaaattgattgttta
gtcggagaaaaacacgcatacgaaataaaatggtgggatgcaactacagatggagaccat
ataactaaagaacacactagaataaaagttattcataacaaaggatatataccaattcgg
ttaatgttctactatccaaatagaactcaagctataaaaattcagcaaactttagaaaca
ttgtataacggtattggagggaaatattattatggagattctgcctgggaacatttaaga
gcagtgaccggtattgatttacttagtattctaacagatattgcaaataaaaaaacaggg
gtaaaatcaaaatga

DBGET integrated database retrieval system