KEGG   Streptococcus pneumoniae SPNA45 (serotype 3): SPNA45_00933Help
Entry
SPNA45_00933      CDS       T02245                                 

Gene name
smc
Definition
(GenBank) putative chromosome partition protein
  KO
K03529  chromosome segregation protein
Organism
snu  Streptococcus pneumoniae SPNA45 (serotype 3)
Brite
KEGG Orthology (KO) [BR:snu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:snu03036]
    SPNA45_00933 (smc)
Chromosome and associated proteins [BR:snu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    SPNA45_00933 (smc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_15 AAA_29 SbcCD_C AAA_18
Motif
Other DBs
NCBI-ProteinID: CCM08219
LinkDB All DBs
Position
917228..920767
Genome map
AA seq 1179 aa AA seqDB search
MYLKEIEIQGFKSFADKTKVVFDQGVTAVVGPNGSGKSNITESLRWALGESSVKSLRGGK
MPDVIFAGTESRKPLNYASVVVTLDNHDGFIKDAGQEIRVERHIYRSGDSEYKIDGKKVR
LRDIHDLFLDTGLGRDSFSIISQGKVEEIFNSKPEERRAIFEEAAGVLKYKTRRKETESK
LQQTQDNLDRLEDIIYELDNQIKPLEKQAENARKFLDLEGQRKAIYLDVLVAQIKENKAE
LESTEEELAQVQELLMSYYQKREKLEEENQTLKKQRQDLQAEMAKDQGSLMDLTSLISDL
ERKLALSKLESEQVALNQQEAQARLAVLEDKRNSLSQEKSDKESSLVLLEENLVQNNQKL
NRLEAELLAFSDDPDQMIELLRERFVALLQEEADVSNQLTRIENELENSRQLSQKQADQL
EKLKEQLATAKEMASQQKDELETAKVQVQKLLADYQAIAKEQEEQKTSYQAQQSQLFDRL
DSLKNKQARAQSLENILRNHSNFYAGVKSVLQEKDRLGGIIGAVSEHLTFDVHYQTALEI
ALGASSQHIIVEDEESATKAIDFLKRNRAGRATFLPLTTIKARTISSQNQDVIAASAGFL
GMADELVTFDTRLEAIFKNLLATTAIFDTVEHARAAARKVRYQVRMVTLDGTELRTGGSY
AGGANRQNNSIFIKPELEQLQKEIAEEEASLRSDEVSLKNLQDELARLTERLEAIKSQGE
QARIQEQGLSLAYQQTSQQVEELETLWKLQEEELNRLSEGEWQADKEKCQERLTTITSEK
NNLEAEIEEIKSNKNAIQERYQNLQEEVAQARLLKTELQGQKRYEVTDIERLGKELDNLD
IEQEEIQRLLQEKVDNLEKVDTELLSQQAEESKTQKTNLQQGLIRKQFELDDIEGQLDDI
ASHLDQARQQNEEWIRKQTRAEAKKEKVSERLRHLQSQLTDQYQISYTEALEKAHELDNL
NLAEQEVQDLEKAIRSLGPVNLDAIDQYEEVHSRLDFLNSQRDDILSAKNLLLEIITEMN
DEVKERFKSTFEAIRESFKVTFKQMFGGGQADLILTEGDLLTAGVEISVQPQGKKIQSLN
LMSGGEKALSALALLFSIIRVKTIPFVILDEVEAALDEANVKRFGDYLNRFDKDSQFIVV
THRKGTMAAADSIYGVTMQESGVSKIVSVKLKDLESIEG
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaaaggaaatcgaaattcaggggttcaagtcttttgctgataagaccaaggtc
gtttttgaccaaggtgtgacggcagttgttggacccaatggatctggaaagtccaatatt
acagaaagtctgcgttgggctttgggggagtctagtgtcaagagtctccgtgggggcaag
atgccggatgtcatctttgctggaaccgaaagtcgcaaaccgctcaattatgcttctgta
gttgtgactctggataatcatgacggatttatcaaggatgcaggtcaagaaatcagggtg
gaacgccatatctatcgtagtggagatagcgaatacaagattgacggcaagaaagtccgt
ctgcgtgatattcatgacctcttcttggatactggattgggacgagattccttctctatt
atttcccaagggaaggttgaggagatttttaattccaagcctgaggaacgacgagctatt
tttgaagaagctgctggagttttaaaatacaagactcgcagaaaagaaaccgagagtaaa
ctgcagcaaactcaggataatctggaccgcttagaggacattatctacgagttggataat
caaatcaagcctcttgaaaagcaagctgagaatgcccgtaagtttttagacttggaagga
caacgtaaggctatttatttagatgttctggttgctcaaatcaaggaaaataaggctgaa
ctagagtcgacagaagaagagttggctcaggttcaagaactcttgatgagttattaccaa
aagcgtgaaaaattagaagaagaaaatcaaactcttaaaaagcaacgccaagatttacag
gctgaaatggccaaagaccaaggcagtttgatggatttgaccagtctgattagtgattta
gagagaaaattagccctatcgaaattagaatctgagcaagtagccctgaatcaacaggaa
gcacaagctcgtttggctgttttggaggataagagaaattcactcagccaagaaaaatct
gataaagaaagctctttagtacttttagaggaaaatctagtccaaaataatcaaaaactc
aatcgtttagaagctgaattgctagctttttcagatgatcctgatcagatgattgagctt
ttgcgtgaacgctttgtggcgcttttacaagaagaagcggatgtctcaaaccaactgacc
cgcatcgagaatgagttggaaaatagtcgtcagctttctcaaaaacaagcagatcaacta
gaaaagctgaaagagcaattagctacagctaaagagatggctagtcagcaaaaagacgag
cttgaaactgccaaggtgcaggttcagaaattattggctgactatcaagctattgccaag
gagcaagaggagcaaaaaacttcctatcaagctcaacaaagtcaactctttgaccgtctg
gatagtcttaaaaacaagcaggctagagctcaaagtttggaaaacatccttagaaatcac
agtaacttttatgcaggtgtaaagagtgttctccaagaaaaagaccgccttggtgggatt
attggtgctgttagtgagcatttgacctttgatgtgcattatcaaactgccttagagatt
gcacttggagccagcagtcagcatatcatcgtagaagatgaagagtcggcaaccaaggcg
attgatttcctcaaacgaaatagagctggtcgtgcaaccttccttccgttgacgactatc
aaggcgcgtacgatttctagtcagaaccaagatgttatcgctgcaagtgcgggatttcta
ggcatggcagatgagttggtgacattcgatacgagactggaagctattttcaagaacttg
ctagctacgacagcgatttttgataccgttgagcatgcgcgtgcagcagcgcgcaaagtt
cgttatcaggttcgtatggtgactttggacggtacagagttgcgcacaggtggttcttac
gcaggtggagccaatcgtcagaataacagtattttcatcaagccagaactggagcaatta
caaaaagaaattgctgaagaagaagcaagtttgcgttcagatgaagtgagtttgaagaac
ttgcaagatgagctagctagattgacagaaagattagaagccatcaaatctcagggagag
caggctcgtattcaggagcaaggcttgtccctcgcctatcagcagaccagtcagcaagtt
gaagagctagaaactctttggaaactccaagaagaggaattaaatcgtctttctgaggga
gaatggcaagcggataaggaaaaatgccaagagcgccttactacaatcactagtgaaaag
aataatctggaagctgagattgaagagattaagtctaataaaaacgccatccaagaacgt
tatcaaaacttgcaggaagaggtagctcaagctcgtctacttaagacagaactgcaaggg
caaaaacgttatgaagtgactgatattgaacgcttaggtaaggaactagataatcttgat
attgagcaagaagaaattcagcgccttcttcaagaaaaggttgacaatcttgagaaggtt
gatacagaattgctcagtcaacaggcggaagaatccaaaactcagaaaacgaacctccaa
caaggtttgattcgcaaacagtttgagttggatgatatagaaggtcagctggatgatatt
gctagtcatttggatcaggctcgccagcagaatgaggagtggattcgcaagcaaacacgt
gctgaagccaagaaagaaaaggtcagcgagcgcttgcgccatctacaaagtcaattaaca
gaccagtaccagattagctatactgaagcactagaaaaagcgcatgagttggacaatctc
aatctggcagagcaagaggtgcaggatttagagaaggctattcgctcactgggtcctgtc
aacttggatgctattgaccagtacgaagaagttcacagccgtctggatttcctcaatagc
cagcgagatgacattttgtcagcgaaaaatctgcttcttgagattattacagagatgaat
gatgaggtcaaggaacgctttaaatcaacctttgaagctatccgtgagtcctttaaagtg
accttcaagcagatgtttggcggaggtcaagcggacctgattttgactgagggagacttg
ctgacagctggggttgagatttctgttcaacctcaaggtaagaaaatccagtcccttaat
ctcatgagtggtggtgaaaaagctctatcggctcttgccttgctcttctccattattcgt
gtcaagactattccatttgttatcttggatgaggtggaagctgcgctggatgaagccaat
gttaaacgttttggggattacctcaaccgctttgacaaggacagccagtttatcgtcgta
acccaccgtaagggaaccatggcagcggctgattccatctatggagtgaccatgcaagaa
tcgggtgtttcaaagattgtttcagttaagttaaaagatttagaaagtattgaaggatga

DBGET integrated database retrieval system