KEGG   Streptococcus pneumoniae SPNA45: SPNA45_01314Help
Entry
SPNA45_01314      CDS       T02245                                 

Gene name
tdk
Definition
(GenBank) putative thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
snu00240  Pyrimidine metabolism
snu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPNA45_01314 (tdk)
Enzymes [BR:snu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SPNA45_01314 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD AAA_30
Motif
Other DBs
NCBI-ProteinID: CCM08599
LinkDB All DBs
Position
join(1322139..1322498,1322502..1322729)
Genome map
AA seq 195 aa AA seqDB search
MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRDGVGYVSSRIGMKRPAL
AIEETTDIFGYIRDLPEKPYCVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRN
LFEGSKYLLLLADKIDEIKTICQHCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVCR
KHYFAPEINKENEEK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttgtactatcgttatggaaccatgaactctggtaaaacgattgagattctc
aaagtggcctataactacgaggagcaaggaaaaggtgttgtcattatgacctcggctctg
gatacgcgtgacggtgttggctatgtgtcgagtcgaattggcatgaaacgccctgccctt
gcgattgaggaaacaacggatatctttggctatatccgagacctaccagaaaaaccttac
tgtgttttggtcgatgaagcccagtttctcaaacgccaccatgtttacgacctagctcgt
gttgtggacgagttagacatacccgtcatggcttttggcttgaaaaatgactttcgcaat
ttgttcgaaggttccaaatatctcttgcttttagcggacaagattgacgaaatcaagacc
atctgtcagcattgcaagaaaaaggcgaccatggtgttgcgaacacaggatggactgccc
gtttacgatggagaacagatccagattggtggtaatgaaacctatatctcggtttgccgt
aaacattattttgcccctgaaatcaataaggagaatgaagaaaaatga

DBGET integrated database retrieval system