KEGG   Streptococcus pneumoniae INV200 (serotype 14): SPNINV200_06770Help
Entry
SPNINV200_06770   CDS       T02073                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
snv  Streptococcus pneumoniae INV200 (serotype 14)
Brite
Enzymes [BR:snv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SPNINV200_06770 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CBW34310
LinkDB All DBs
Position
687897..688502
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEKHPEIGEDLEALLADV
ESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAIDATFGSFEEFQAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVDELYAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattatcttaccagaacttccatatgcatacgacgctttggaaccatacatcgat
gcggaaacaatgcatttgcaccatgacaaacaccatcaaacttatgtcaacaatgccaat
gcagctttagaaaaacaccctgaaatcggtgaagaccttgaagccttgcttgctgatgta
gaatctatcccagctgatatccgtcaagcacttatcaacaatggtggcggacacttgaac
cacgctcttttctgggaattgatgactcccgagaaaacagctccttcagcagaactggca
gcagcaatcgatgcaacatttggttcatttgaagaattccaagcagccttcactgcagca
gcaacaactcgttttggttcaggttgggcatggttggttgtcaacaaagaagggaaactt
gaagtgacttcaacagcaaaccaagacacaccaatctcagaaggtaaaaaaccaatcttg
ggcttggacgtttgggaacatgcttactacgtgaaataccgcaacgtgcgtcctgactac
atcaaagctttcttttcagtaatcaactggaataaagtagatgaattgtacgcagctgct
aaataa

DBGET integrated database retrieval system