KEGG   Streptococcus pneumoniae INV200 (serotype 14): SPNINV200_15140Help
Entry
SPNINV200_15140   CDS       T02073                                 

Gene name
nanA
Definition
(GenBank) sialidase A (neuraminidase A)
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
snv  Streptococcus pneumoniae INV200 (serotype 14)
Pathway
snv00511  Other glycan degradation
snv00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:snv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SPNINV200_15140 (nanA)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPNINV200_15140 (nanA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:snv02042]
    SPNINV200_15140 (nanA)
Enzymes [BR:snv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SPNINV200_15140 (nanA)
Bacterial toxins [BR:snv02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SPNINV200_15140 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sialidase BNR_2 Laminin_G_3 BNR_3 YSIRK_signal BNR Gram_pos_anchor Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: CBW35147
LinkDB All DBs
Structure
PDB: 

Position
complement(1542795..1545692)
Genome map
AA seq 965 aa AA seqDB search
MNRSVQERKCRYSIRKLSVGAVSMIVGAVVFGTSPVLAQEGASEQPLANETQLSGESSTL
TDTEKSQPSSETELSGNKQEQERKDKQEEKIPRDYYARDLENVETVIEKEDVETNASNGQ
RVDLSSELDKLKKLENATVHMEFKPDAKAPAFYNLFSVSSATKKDEYFTMAVYNNTATLE
GRGSDGQQFYGNYNDAPLKVKPGQWNSVTFTVEKPTAELPKGRVRLYVNGVLSRTSLKSG
NFIKDMPDVTHVQIGATKRANNTVWGSNLQIRNLTVYNRALTPEEVQKRSQLFKRSDLEK
KLPEGAVLTEKTDIFESGRNGKPNKDGIKSYRIPALLKTDKGTLIAGADERRLHSSDWGD
IGMVIRRSEDNGKTWGDKVVISNLRDNPEAKDPAAPSPLNIDMVLVQDPTTKRIFSIYDM
FPEGRAVFGMPKTPEKAYEKIGDKTYQILYKQGESGHYTVRENGEVYNAQNQKTDYRVVV
NPTEPGYRDKGNLYKGQELIGNIYFAHSTKNPFRVANTSYLWMSYSDDDGKTWSAPRDIT
PGLRKDWMKFLGTGPGTGIVLRNGPHKGRILIPVYTTNNVSHLNGSQSSRVIYSDDHGKT
WHAGEAVNDNRQVDGQKIHSSTMNNERAQNTESTVVQLNNGDVKLFMRGLTGDLQVATSK
DGGVTWEKDIKRYPQVKDVYVQMSAIHTMHEGKEYIILSNAGGPKRENGMVHLARVEENG
ELTWLKHNPIQKGEFAYNSLQELGNGEYGILYEHTEKGQNAYTLSFRKFNWDFLSKDLIS
PTEAKVKRTREMGKGEMGKGVIGLEFDSEVLVNKAPTLQLANGKTATFLTQYDSKTLLFA
VDKEDIGQEIIGIAKGSIESMHNLPVNLAGARVPGGVNGSKAAVHEVPEFTGGVNGTEPA
VHEIAEYKGSDSLVTLTTKEDYTYKAPLAQQALPETGNKESDLLASLGLTAFFLGLFTLG
KKREQ
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggagtgttcaagaacgtaagtgtcgttatagcattaggaaactatcggtagga
gcggtttctatgattgtaggagcagtggtatttggaacgtctcctgttttagctcaagaa
ggggcaagtgagcaacctctggcaaatgaaactcaactttcgggggagagctcaacccta
actgatacagaaaagagccagccttcttcagagactgaactttctggcaataagcaagaa
caagaaaggaaagataagcaagaagaaaaaattccaagagattactatgcacgagatttg
gaaaatgtcgaaacagtgatagaaaaagaagatgttgaaaccaatgcttcaaatggtcag
agagttgatttatcaagtgaactagataaactaaagaaacttgaaaacgcaacagttcac
atggagtttaagccagatgccaaggccccagcattctataatctcttttctgtgtcaagt
gctactaaaaaagatgagtacttcactatggcagtttacaataatactgctactctagag
gggcgtggttcggatgggcaacagttttacggtaattacaacgatgcacccttaaaagtt
aaaccaggtcagtggaattctgtgactttcacagttgaaaaaccgacagcagaactacct
aaaggccgagtgcgcctctacgtaaacggggtattatctcgaacaagtctgaaatctggc
aatttcattaaagatatgccagatgtaacgcatgtgcaaatcggagcaaccaagcgtgcc
aacaatacggtttgggggtcaaatctacagattcggaatctcactgtgtataatcgtgct
ttaacaccagaagaggtacaaaaacgtagtcaactttttaaacgctcagatttagaaaaa
aaactacctgaaggagcggttttaacagagaaaacggacatattcgaaagcgggcgtaac
ggtaaaccaaataaagatggaatcaagagttatcgtattccagcacttctcaagacagat
aaaggaactttgatcgcaggtgcagatgaacgccgtctccattcgagtgactggggtgat
atcggtatggtcatcagacgtagtgaagataatggaaagacatggggagataaggtggtt
atctccaatcttcgagataatcctgaagctaaagatcctgctgcgccatcgcctctaaat
attgatatggttttggttcaagacccgacaacaaagagaatcttctcaatttatgatatg
ttcccagaaggtcgagcagtttttggaatgccaaaaacacctgaaaaagcttatgaaaag
ataggggataaaacttatcaaatcttgtataaacaaggagagtctggtcattatactgtt
cgtgagaatggagaagtgtataatgcacaaaatcaaaagacggattatcgtgttgtagtg
aatccaacagaacctggctatagagataaaggaaatctttacaaaggtcaggaattgatt
ggaaatatctattttgcacacagtacaaaaaatccatttagagtagccaatacgagctat
ctatggatgtcatatagtgacgatgatggtaaaacttggtctgcaccgagagacattact
ccaggtcttcgcaaggattggatgaagttcctaggaacaggtcctggaacaggaattgta
cttcggaatgggcctcacaagggacggattttgataccggtttatacgactaataatgta
tctcacttaaatggctcgcaatcttctcgtgtcatctattcagatgatcatggaaaaact
tggcatgctggagaagcggtcaacgataaccgtcaggtagacggtcaaaagatccactct
tctacgatgaacaatgaacgtgcgcaaaatacagaatcaacggtggtacaactaaacaat
ggagatgttaaactctttatgcgtggtttgactggagatcttcaggttgctacaagtaaa
gacggaggagtgacttgggagaaggatatcaaacgttatccacaggttaaagatgtctat
gttcaaatgtctgctatccatacgatgcacgaaggaaaagaatacatcatcctcagtaat
gcaggtggaccgaaacgtgaaaatgggatggtccacttggcacgtgtcgaagaaaatggt
gagttgacttggctcaaacacaatccaattcaaaaaggagagtttgcctataattcgctc
caagaattaggaaatggggagtatggtatcttgtatgaacatactgaaaaaggacaaaat
gcctataccctatcatttagaaaatttaattgggactttttgagcaaagatctgatttct
cctaccgaagcgaaagtgaagcgaactagagagatgggcaaaggagagatgggcaaagga
gttattggcttggagttcgactcagaagtattggtcaacaaggctccaacccttcaattg
gcaaatggtaaaacagcgactttcctaacccagtatgatagcaagaccttgttgtttgca
gtagataaggaagatatcggacaggaaattattggtatagctaaaggaagcatcgaaagt
atgcataatcttcctgtaaatctagcaggtgccagagttcctggcggagtaaatggtagc
aaagcagcggtgcatgaagttccagaatttacagggggagttaatggtacagagccagct
gttcatgaaatcgcagagtataagggatctgattcgcttgtaactcttactacaaaagaa
gattatacttacaaagctcctcttgctcagcaggcacttcctgaaacaggaaacaaggag
agtgacctcctagcttcactaggactaacagctttcttccttggtctgtttacgctaggg
aaaaagagagaacaataa

DBGET integrated database retrieval system