KEGG   Streptomyces niveus: BBN63_04695Help
Entry
BBN63_04695       CDS       T04887                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
snw  Streptomyces niveus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AQU65640
UniProt: A0A1U9QN88
LinkDB All DBs
Position
1124983..1126047
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPMKPMLAKSVAKIPPGMQYEAKWDGFRALIHRDGDEVVIGSRNGKPLTRYFPE
LVTAFLRELPERCVIDGEIVIAYEGRLDFDRLSERIHPADSRVRTLAERTPASFVAFDLL
ALEDRSLLATPQSERRAALVDALGGVSAPVHLAPATTDPELAQEWFRRYEGAGLDGVVAK
PLDLPYRPDVRVMYKIKHERTADVVVAGYRLHKSGPVVGSLLLGLHDTAGTLQHVGVCAA
FSMKRRAELVDELAPLVMDSTEGHPWAAWARESAHESARLPGAPSRWTGKKDLSWIAVRP
ELVCEVAYDHMEGDRFRHTAQFRRWRPDRTPGECTYAQLEEPVRYDLAEVLASG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccggtgatgcctccgatgaaaccgatgctggccaagtccgtggcgaaaatc
ccgcccggtatgcagtacgaggccaagtgggacggcttccgtgcgctgatccaccgggac
ggcgacgaggtcgtgatcggcagcaggaacggcaagccgctgacccgctacttccccgag
ctggtcaccgccttcctgcgtgagctgcccgagcggtgcgtgatcgacggcgagatcgtg
atcgcgtacgagggccggctggacttcgaccggctcagcgagcgcatccacccggcggac
tcgcgggtgcggacgctcgccgagcggaccccggcgagtttcgtcgccttcgacctgctg
gcgctggaggaccggtcgctgctggccaccccgcagtccgaacgccgcgcggcgctcgtc
gacgccctcgggggcgtctcggcccccgtccatctggcaccggccaccacggacccggag
ctggcccaggagtggttccggcgctacgagggcgccgggctggacggggtggtcgccaag
ccgctggacctgccgtaccggcccgacgtacgcgtgatgtacaagatcaagcacgagcgg
accgcggacgtggtcgtggccggataccgcctccacaagagcggcccggtcgtcggctcc
ctgcttctcggcctgcacgacacggccgggacgctccagcacgtgggggtgtgcgccgcg
ttctccatgaagcgccgggccgagttggtggacgagctggctccgctggtgatggattcc
accgaggggcatccgtgggcggcctgggcgcgggagtcggcccacgagagcgccagactg
cccggcgcgccgagccgctggacgggcaagaaggacctgtcgtggatcgcggtgcggccg
gagctggtgtgcgaggtggcgtacgaccacatggagggcgaccgcttccggcacacggcg
cagttccgccggtggcgcccggaccgtacgcccggggagtgcacgtacgcgcagttggag
gagccggtgcgctacgacctggccgaggtgctggcgtcgggctga

DBGET integrated database retrieval system