KEGG   Streptomyces niveus: BBN63_12145Help
Entry
BBN63_12145       CDS       T04887                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
snw  Streptomyces niveus
Pathway
snw00020  Citrate cycle (TCA cycle)
snw00190  Oxidative phosphorylation
snw00650  Butanoate metabolism
snw01100  Metabolic pathways
snw01110  Biosynthesis of secondary metabolites
snw01120  Microbial metabolism in diverse environments
snw01130  Biosynthesis of antibiotics
snw01200  Carbon metabolism
Module
snw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
snw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
snw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:snw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBN63_12145
   00650 Butanoate metabolism
    BBN63_12145
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BBN63_12145
Enzymes [BR:snw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BBN63_12145
    1.3.5.4  fumarate reductase (quinol)
     BBN63_12145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 HI0933_like Pyr_redox_2 DAO
Motif
Other DBs
NCBI-ProteinID: AQU66882
UniProt: A0A1U9QRK6
LinkDB All DBs
Position
2884360..2886114
Genome map
AA seq 584 aa AA seqDB search
MKIHKYDTVIVGAGGAGMRAAIESTKRSRTAVLTKLYPTRSHTGAAQGGMAAALANVEED
NWEWHTFDTIKGGDYLVDQDAAEILAKEAIDAVLDLEKMGLPFNRTPGGTIDQRRFGGHS
RNHGEAPVRRSCYAADRTGHMILQTLYQNCVKEGVEFFNEFYVLDQLIVEIDGVKTSAGV
VAYELATGEIHVFQAKSVIYASGGTGKFFKVTSNAHTLTGDGQAACYRRGLPLEDMEFFQ
FHPTGIWRMGILLTEGARGEGGILRNKDGERFMEKYAPVMKDLASRDVVSRSIYTEIREG
RGCGPEGDHVYLDLTHLPPEQLDAKLPDITEFARTYLGIEPYTDPIPIQPTAHYAMGGIP
TNVQGEVLRDNTTVVPGLYAAGEVACVSVHGANRLGTNSLLDINVFGKRSGIAAAEYAAK
SEHVELPENPAELVESQIQRLRDSTGDERVADIRRELQETMDANVMVFRTEQTIKTAVEK
IGELRERYLRVSIQDKGRRFNTDLLEAVELGNLLDLAEVMAVSALARKESRGGHYREDFP
NRDDVNFMRHTMAYREVGDDGTESIRLDYKPVVQTRYQPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccataagtacgacaccgtcatcgtcggcgccggcggcgccggtatgcgcgcg
gccatcgagtcgaccaagcgcagccgcaccgccgtgctgacgaagctgtatcccaccagg
tcccacacgggcgccgcgcagggcggtatggccgccgcgctcgccaacgtggaggaggac
aactgggagtggcacaccttcgacacgatcaagggcggcgactacctggtcgaccaggac
gccgccgagatcctggcgaaggaggccatcgacgcggtcctggacctggagaagatgggt
ctgccgttcaacaggacgccgggcggcaccatcgaccagcgccgcttcggcggccactcc
cgcaaccacggcgaggccccggtccgccggtcctgctacgcggccgaccgcaccggccac
atgatcctccagacgctctaccagaactgtgtcaaggagggtgtggagttcttcaacgag
ttctacgtcctcgaccagttgatcgtggagatcgacggcgtcaagacgtcggcgggtgtg
gtcgcctacgagctggccaccggcgagatccatgtcttccaggcgaagtcggtcatctac
gcgtccggcggcaccggcaagttcttcaaggtgacgtccaacgcgcacacgctcaccggt
gacggccaggcggcctgctaccggcgcggactgccgctggaggacatggagttcttccag
ttccacccgacgggcatctggcgcatgggcatcctcctcacggagggcgcccgcggtgag
ggcggcatcctccgtaacaaggacggcgagcgcttcatggagaagtacgcgcccgtcatg
aaggacctcgcctcgcgtgacgtcgtctcgcggtcgatctacaccgagatccgcgagggc
cggggctgcggtcccgagggcgaccacgtctacctcgacctgacgcacctgccgccggag
cagctggacgccaagctcccggacatcaccgagttcgcccgtacgtacctgggcatcgag
ccgtacacggacccgatcccgatccagcccaccgcgcactacgcgatgggcggcatcccg
accaacgtccagggcgaggtcctgcgcgacaacacgacggtggtgcccggtctgtacgcg
gccggcgaggtcgcgtgcgtgtcggtgcacggcgccaaccggctcggcaccaactcgctg
ctcgacatcaacgtcttcggcaagcgctccggcatcgccgccgccgagtacgcggccaag
agtgagcacgtcgaactcccggagaacccggccgaactggtcgagtcgcagatccagcgg
ctgcgtgactccacgggcgacgagcgcgtggcggacatccgccgcgaactccaggagacc
atggacgcgaacgtcatggtcttccgcacggagcagacgatcaagacggccgtcgagaag
atcggcgagctgcgcgagcgctatctgcgcgtgtccatccaggacaagggccggcgcttc
aacacggatctgctggaggccgtcgagctgggcaacctgctcgacctggccgaggtgatg
gccgtgtcggcgctcgcccgcaaggagtcgcgcggcggtcactaccgcgaggacttcccc
aaccgggacgacgtgaacttcatgcgccacaccatggcgtatcgcgaggtcggcgacgac
ggcacggagtccatccgtctcgactacaagccggtcgtccagacccgctaccagccgatg
gagcgtaagtactga

DBGET integrated database retrieval system