KEGG   Streptomyces niveus: BBN63_12150Help
Entry
BBN63_12150       CDS       T04887                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
snw  Streptomyces niveus
Pathway
snw00020  Citrate cycle (TCA cycle)
snw00190  Oxidative phosphorylation
snw00650  Butanoate metabolism
snw01100  Metabolic pathways
snw01110  Biosynthesis of secondary metabolites
snw01120  Microbial metabolism in diverse environments
snw01130  Biosynthesis of antibiotics
snw01200  Carbon metabolism
Module
snw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
snw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
snw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:snw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBN63_12150
   00650 Butanoate metabolism
    BBN63_12150
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BBN63_12150
Enzymes [BR:snw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BBN63_12150
    1.3.5.4  fumarate reductase (quinol)
     BBN63_12150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_4 Fer4 Fer4_18 Fer4_16 Fer4_6 Fer4_2 Fer4_21 Fer4_15
Motif
Other DBs
NCBI-ProteinID: AQU66883
UniProt: A0A1U9QSA1
LinkDB All DBs
Position
2886114..2886893
Genome map
AA seq 259 aa AA seqDB search
MATPLLDKVEDESAASPYITVTLRIRRFNPEISDESRWEDFSIEIDPKERVLDALHKIKW
DVDGSLTFRRSCAHGICGSDAMRINGKNRLACKTLIKDITSIDKKTGAPKPITVEAIKGL
TVLKDLIVDMDPFFQAYRDVMPFLVTSGNEPTRERLQSAEDRERFDDTTKCILCAACTSS
CPVFWNDGQYFGPAAIVNAHRFIFDSRDEAGEQRLEILNDKDGVWRCRTTFNCTDACPRG
IEVTKAIQEVKRALITRRF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcccctactggacaaggtcgaggacgagtccgcggcgtcaccgtacatcacg
gtcacgctgcggatccgccgcttcaacccggagatctccgacgagtcccgctgggaggac
ttctcgatcgagatcgaccccaaggagcgtgtgctcgacgccctccacaagatcaagtgg
gacgtcgacggctcgctgaccttccggcgctcctgcgcgcacgggatctgcggctcggac
gcgatgcggatcaacggcaagaaccggctcgcgtgcaagacgctgatcaaggacatcacg
tcgatcgacaagaagacgggtgctccgaagccgatcacggtcgaggccataaagggactc
acggtcctgaaagacctgatcgtggacatggacccgttcttccaggcgtaccgcgacgtg
atgccgttcctggtcaccagcggcaacgagccgacgcgtgagcgccttcagtcggcggag
gaccgcgagcggttcgacgacaccacgaagtgcatcctgtgcgcggcgtgcacgtcgtcg
tgcccggtgttctggaacgacgggcagtacttcggcccggcggcgatcgtcaacgcgcac
cggttcatcttcgactcgcgtgacgaggcgggcgagcagcgcttggagatcctcaacgac
aaggacggcgtgtggcgttgccgcacgacgttcaactgcacggacgcctgcccgcgcggt
atcgaggtcaccaaggcgatccaggaagtgaagcgcgcgctgatcacccggcgcttctga

DBGET integrated database retrieval system