KEGG   Streptomyces niveus: BBN63_12200Help
Entry
BBN63_12200       CDS       T04887                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
snw  Streptomyces niveus
Brite
KEGG Orthology (KO) [BR:snw00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BBN63_12200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AQU66891
UniProt: A0A1U9QSU2
LinkDB All DBs
Position
complement(2895167..2896126)
Genome map
AA seq 319 aa AA seqDB search
MDWLKKLPVVGPLVARLMLTHAWRSYETLDRTHWSRLAAAITFISFLALFPLITVSAAIG
ATLLSKDQLDRLQDKLTDQVPGISDQLDLNALVANAGTVGLVAGALLLFTGIGWVGSMRE
CLRAVWELDVADEGNPFVLKAKDAVILVGLGVTALASIGASALGSTAVGWSADRLGIPEG
GAGGVLLQIAAIVVAAVAGFLILLYVLTLLPGVHPPRRRLIVAAVIGAVGFELLKLLLGG
YVRDVAGKSLYGAFGVPVALLLWINFTAKLMLFCAAWTATPGKDEPSQGEGNTAGTDDDA
TDSAAVAPGATRFSGPAGA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggactggctgaaaaaactccccgtcgtcgggccgctcgtggcccggctgatgctgacg
cacgcctggcgttcctacgagaccctcgaccggacgcactggtcccggctcgcggcggcg
atcaccttcatcagcttcctggcgctcttcccgctgatcaccgtgagcgcggcgatcggg
gccacgctgctcagcaaggaccagctcgaccggctccaggacaagctcaccgaccaggtg
cccggcatctccgaccagctcgatctcaacgcgctggtcgccaacgcgggcaccgtgggc
ctggtggcgggcgcgctgctgctgttcaccggcatcggctgggtcggctcgatgcgggag
tgcctgcgcgccgtgtgggagctggacgtcgcggacgagggaaaccccttcgtactgaag
gccaaggacgcggtcatcctcgtcggcctcggcgtcaccgcgctcgcctcgatcggcgcg
tccgccctcggctccaccgccgtcggctggagcgccgaccggctcggcatcccggagggc
ggcgcgggcggcgtgctgctccagatcgcggcgatcgtcgtggcggccgtcgccggcttc
ctcatcctgctgtacgtgctgacgctgctgccaggcgtgcatccgccacggcgccggctg
atcgtcgccgcggtgatcggcgcggtcggcttcgaactgctcaagctgctgctcggcggc
tatgtgcgtgacgtcgcgggcaagagcctgtacggcgcgttcggggtaccggtcgcgctg
ctgctgtggatcaacttcacggcgaagctgatgctgttctgtgccgcctggacggctacg
ccgggcaaggacgagccgtcacagggggaggggaacacggcggggacggacgacgacgcg
acggattcggcggcggtcgcccccggcgcgacacgctttagcggcccggcaggcgcttga

DBGET integrated database retrieval system