KEGG   Streptomyces niveus: BBN63_14295Help
Entry
BBN63_14295       CDS       T04887                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
snw  Streptomyces niveus
Pathway
snw00250  Alanine, aspartate and glutamate metabolism
snw00410  beta-Alanine metabolism
snw00430  Taurine and hypotaurine metabolism
snw00650  Butanoate metabolism
snw01100  Metabolic pathways
snw01110  Biosynthesis of secondary metabolites
snw01120  Microbial metabolism in diverse environments
snw02024  Quorum sensing
Module
snw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:snw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BBN63_14295
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBN63_14295
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBN63_14295
   00430 Taurine and hypotaurine metabolism
    BBN63_14295
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBN63_14295
Enzymes [BR:snw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BBN63_14295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AQU70906
UniProt: A0A1U9R338
LinkDB All DBs
Position
3342602..3344020
Genome map
AA seq 472 aa AA seqDB search
MRGPADNPADNHSERLRLSLNPFFGEADPIGSMTSAPPTHRLPDGPMPPSTAYQLVHDEL
MLDGNSRLNLATFVTTWMERQAGVLMAECRDKNMIDKDEYPRTAELERRCVTMLADLWNA
PDPSAAVGCSTTGSSEACMLAGLALKRRWTTKNRDRYPGSARPNLVMGVNVQVCWEKFCN
FWEVEARLVPMEGDRFHLDPQAAADLCDENTIGVVAVLGSTFDGSYEPVAELCATLDALQ
ERRGWDIPVHVDGASGAMVAPFLDEDLVWDFRLPRVSSINTSGHKYGLVYPGVGWALWRT
SAELPEELVFRVNYLGGEMPTFALNFSRPGAQVVAQYYTFLRLGRDGYRAVQQTARDVAR
GLADEIGAMDDFRLLTHGNELPVFAFTTAPHVKNFDVFDVSRRLREHGWLMPAYTFPANR
EDLSVLRVVCRNGFSADLAAMLLADLRLLLPELRRQPHPLDRDKSRATAFHH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ctgaggggcccggcggacaatccggcggacaatcactccgagcggctcaggctgtcgctc
aaccccttcttcggggaggccgacccgatcggcagcatgacgtccgccccgcccacgcac
cggctgccggacggccccatgcccccgtccacggcctaccagctcgtccacgacgagctg
atgctggacggcaactcccggctcaatctggccaccttcgtcaccacctggatggagcga
caggccggtgtgctgatggcggagtgccgggacaagaacatgatcgacaaggatgagtac
ccgcggaccgccgaattggagcggcggtgcgtcacgatgctcgccgacctctggaacgcc
cccgacccgtccgccgccgtcggctgctccaccaccggctccagcgaggcctgcatgctc
gccggtctcgcgctcaagcgccgttggaccacgaagaaccgggaccgctatccgggcagc
gcccggcccaatctcgtgatgggcgtcaacgtccaggtctgctgggagaagttctgcaac
ttctgggaggtcgaggcccgtctcgtccccatggagggcgatcgcttccatctcgacccg
caggcggcggccgatctctgcgacgagaacaccatcggcgtcgtcgccgtgctcggctcg
accttcgacggctcgtacgaacccgtcgccgaactctgcgccaccctcgacgcgctccag
gagcggcgcggttgggacatccccgtccatgtcgacggcgcctccggcgcgatggtcgcg
cccttcctcgacgaggacctggtctgggacttccggctgccgcgcgtctcctcgatcaac
acctccgggcacaaatacggcctggtctacccgggcgtcggctgggcgctgtggcgcact
tcggccgaactgcccgaggaactggtcttccgcgtcaactacctgggcggggagatgccc
accttcgcgctcaacttctcccggcccggcgcgcaggtcgtcgcccagtactacaccttc
ctgcggctcggccgcgacggctaccgggccgtccagcagacggcgcgggacgtggcccga
gggcttgccgacgagatcggggccatggacgacttccggctgctcacccacgggaacgaa
ctgcccgtcttcgccttcaccaccgcgccccacgtgaagaacttcgacgtcttcgacgtc
tcgcggcgcctgcgggagcacggctggctcatgcccgcctacaccttcccggccaaccgc
gaggatctgtccgtccttcgcgtggtgtgccgcaacggattctcggccgacctcgccgcg
atgctgctcgccgatctgcggctgctgctgccggaactgcgccgccagccgcacccgttg
gaccgggacaagtcgagggcgacggccttccaccattga

DBGET integrated database retrieval system