KEGG   Streptomyces niveus: BBN63_21955Help
Entry
BBN63_21955       CDS       T04887                                 

Definition
(GenBank) bi-functional transferase/deacetylase
Organism
snw  Streptomyces niveus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Polysacc_deac_1 Glyco_trans_2_3 Glyco_transf_21 Chitin_synth_2 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: AQU68480
UniProt: A0A1U9QW81
LinkDB All DBs
Position
5109250..5111370
Genome map
AA seq 706 aa AA seqDB search
MRYLLPSLLLVALLAMLMLRGYVHSEILADHRVRPPAATDQVPDRILKGGPVIDARGTTT
PKALKVPDRKLVLTFDDGPDPEWTPKVLDKLKEYDAHAVFFVTGTMASRHPELVRRMVDE
GHEIGLHTFNHPDLAYQTQSRIDWELTQNQLVLAGAAGIRTSLFRPPYSSFADAMDDKSW
PVTEYIGSLGYITVLNNTDSEDWKRPGVHEIIERATPKGTRGSIVLMHDSGGDRSQTVTA
LSRFLPSMQDRGYEFANLTEALGAPSAHTPVSGVELLKGKAFVGAVAVSEGTTAVLVAGL
AAIGVLVIGRFGLMLVLSFAHARKVRRRGFSWGEPVTEPVTVLVPAYNERECIANTVRSL
TQSDHRIEVIVIDDGSTDGTADIVEAMWLPGVHVVRQVNSGKPAALNNGIAHASHDLVVM
MDGDTVFEPSTVRELVQPFGDPRVGAVAGNAKVGNRDTLIGAWQHIEYVMGFNLDRRMYD
VLRCMPTIPGAVGAFRRQALDRVGGMSEDTLAEDTDITMAMHRDGWRVVYAERARAWTEA
PESVQQLWSQRYRWSYGTMQAIWKHRRAVIERGPSGRFGRVGLPLVSLFMVLFPLLAPLI
DVFLLYGLVFGPTRNTVIAWLGVLAVQAVCAAYAFRLDGERMIHLISLPLQQILYRQLMY
VVLLQSWITALTGGRLRWQKLRRTGAVEAPGATTGRRSEDVRRPVA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatctgctgccctcgctgctgctcgtcgccctgctcgcgatgctgatgctgcgc
ggctatgtgcacagcgagatcctggcggaccatcgcgtacgcccgccggccgccaccgat
caggtgcccgaccggatcctcaagggcggcccggtcatagacgcgcgcgggacgaccacg
cccaaggcgctgaaggtccccgaccgcaagctcgtcctgaccttcgacgacggaccggac
cccgagtggacgcccaaggtcctcgacaagctcaaggagtacgacgcgcacgccgtcttc
ttcgtcaccggcacgatggcctcgcgccatccggagctggtgcgaaggatggtcgacgag
ggccatgagatcggcctgcacaccttcaaccacccggatctcgcgtaccagacccagtcc
cgtatcgactgggagctgacacagaaccagctcgtgctcgcgggcgcggccggcatccgc
acctcgctgttccggccgccgtactcctccttcgccgacgcgatggacgacaagtcctgg
ccggtcaccgagtacatcggcagcctcggctacatcaccgtgctcaacaacaccgacagc
gaggactggaagcgtcccggtgtccacgagatcatcgagcgggccaccccgaagggcacc
cgcggctccatcgtgctgatgcatgactcgggcggcgaccgctcgcagaccgtcaccgcg
ctgagccgcttcctgccgagcatgcaggaccgcggatacgagttcgccaacctcaccgag
gcgttgggcgccccgagcgcccacacgcccgtctccggtgtcgaactgctcaagggcaag
gcgttcgtcggggccgtcgcggtctcggagggcaccaccgccgtactggtggccgggctc
gccgcgatcggcgtgctggtcatcgggaggttcgggctgatgctggtgctgtccttcgcg
cacgcgcgcaaggtgcggcggcgcggcttcagttggggcgagccggtcaccgaaccggtg
acggtgctggtgcccgcgtacaacgaacgcgagtgcatagccaacacggtccgctccctg
acgcagagcgaccaccgcatcgaggtcatcgtcatcgacgacggctcgacggacggcacg
gcggacatcgtcgaggcgatgtggctgcccggcgtccatgtcgtacggcaggtcaacagc
ggcaagcccgccgcgctcaacaacggcatcgcgcacgccagtcacgatctcgtcgtgatg
atggacggcgacaccgtcttcgagccgtccaccgtgcgtgagctggtccagccgttcggc
gacccgagggtcggggccgtcgcgggcaacgccaaggtcggcaaccgcgacaccctcatc
ggcgcctggcagcacatcgagtacgtgatgggcttcaatctggaccgccgcatgtacgac
gtactgcgctgcatgcccaccatccccggcgcggtcggcgccttccgccgccaggccctg
gaccgcgtcggcgggatgagcgaggacaccctcgccgaggacaccgacatcaccatggcg
atgcaccgcgacggctggcgggtcgtgtacgcggagcgcgcccgcgcctggaccgaggcg
ccggagtccgtgcagcagttgtggtcccagcgctaccgctggagctacggcacgatgcag
gcgatctggaagcaccgccgcgcggtgatcgagcgcgggccctccggccgcttcggccgg
gtcggactgccgctggtctcgctgttcatggtgctgttcccgctgctcgcgccgctcatc
gacgtgttcctcctgtacgggctggtcttcggccccaccaggaacaccgtgatcgcgtgg
ctcggcgtgctggccgtgcaggcggtctgcgccgcgtacgccttccggctcgacggcgaa
cgcatgatccatctgatctcgctgcccctccagcagattctctaccgacaactcatgtac
gtcgtgctgctccagtcctggatcacggccctcaccggcggacggctccgctggcagaag
ctgcgccgcacgggcgcggtggaggcgccgggggccacgaccgggcggcggagcgaggac
gttcggaggccggtggcatga

DBGET integrated database retrieval system