KEGG   Streptomyces niveus: BBN63_28880Help
Entry
BBN63_28880       CDS       T04887                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
snw  Streptomyces niveus
Pathway
snw00020  Citrate cycle (TCA cycle)
snw00480  Glutathione metabolism
snw01100  Metabolic pathways
snw01110  Biosynthesis of secondary metabolites
snw01120  Microbial metabolism in diverse environments
snw01130  Biosynthesis of antibiotics
snw01200  Carbon metabolism
snw01210  2-Oxocarboxylic acid metabolism
snw01230  Biosynthesis of amino acids
Module
snw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
snw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:snw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBN63_28880
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BBN63_28880
Enzymes [BR:snw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BBN63_28880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AQU69609
UniProt: A0A1U9QZU0
LinkDB All DBs
Position
complement(6736961..6739180)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVEAYASTAGVTVERRDISLAGRIIAGFADRLEEGQ
RIDDALAELGALAKTPAANIIKLPNISASIPQLKAAIAELQEQGYALPDYPDDPKSDEDK
DVRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTSESKTNVAHMDADD
FRSTEKSAVIAEDGTLRIELVGDDGNTTVLRESVPVLAGEVVDASAMRVAALREFLAAQI
ARAKAEDVLFSVHLKATMMKVSDPIIFGHTVRAFFPKTFAEHGHALAAAGLSPNDGLGGI
LKGLESLPEGPAIAESFAAELAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGGEADTLAVIPDSSYAGIYQVVIDDCRANGAYDPSTMGSVSNVGLMARAAEEYGS
HDKTFEIPATGTVRVVDTAGNAVLEQTVSAGDVFRMCQTKDVPIQDWVKLAVTRARATGN
PAVFWLDEGRAHDANLIAKVNAYLPEHDTDGLRIEIMTPVEAIAFSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLINGGGLFETGAGGSAPKHVQQLVKEDYLRWD
SLGEFLALAVSFEHLATTTGNARAQVLADTLDRATGTFLSENKSPSRKVGGIDNRGSHFY
LALYWAQELAKQTEDTQLAGAFTALAETLAEQERTIVDELIAVQGSPVDIGGYYQPDPAK
AEAVMRPSKTFNQAISTLG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgacagactcgaccatcatttacacgcacaccgacgaggccccggccttggccacgtac
tcgttcctgcctgtggtcgaggcctatgcctcgacggcgggggtcacggtggagcgccgt
gacatctccctggcggggcggatcatcgccggattcgccgaccgtctcgaagagggacag
cggatcgacgacgcgctcgcggagctcggcgccctggccaagacccccgcggccaacatc
atcaagctgccgaacatctcggcgtcgatcccgcagctcaaggcggcgatcgcggagctc
caggagcagggttacgcgctccccgactacccggacgacccgaagtcggacgaggacaag
gacgtacgggcgcgctacgacaaggtcaagggcagcgccgtgaacccggtgctgcgcgag
ggcaactcggaccgccgcgcccccgcctcggtcaagaactacgccaaggcgcacccgcac
cgcatgggcgcctggacctccgagtcgaagacgaacgtcgcgcacatggacgccgacgac
ttccgctccaccgagaagtccgccgtgatcgccgaggacggcacgctgcggatcgagctg
gtgggcgacgacgggaacaccaccgtcctgcgcgagtcggtacccgtgctggccggcgag
gtcgtggacgcgtccgcgatgcgcgtggccgcgctgcgtgagttcctcgccgcccagatc
gcccgcgccaaggccgaggacgtgctgttctcggtgcacctcaaggccacgatgatgaag
gtctccgacccgatcatcttcggtcacacggtgcgcgccttcttccccaagacgttcgcg
gagcacggccacgccctcgcggcggccggtctgagccctaacgacggcctcggcggcatc
ctcaagggcctcgagtcgctgcccgagggaccggcgatcgcggagtccttcgcggccgag
ctggccgagggccccgcgctggcgatggtcgactccgacaagggcatcaccaacctgcac
gtgccgagcgatgtcatcgtcgacgcctccatgccggccatgatccgcacctccggccac
atgtggggcccggacggcggcgaggccgacacgctcgcggtcatcccggacagcagctac
gcgggcatctaccaggtcgtcatcgacgactgccgcgccaacggcgcctacgacccgtcg
accatgggctcggtgtccaacgtcggtctgatggcgcgggcggccgaggagtacggcagc
cacgacaagaccttcgagatccccgccaccggcacggtgcgcgtcgtggacaccgcgggc
aacgccgtcctggagcagacggtcagcgccggcgacgtcttccgcatgtgccagaccaag
gacgtgccgatccaggactgggtcaagctcgccgtcacccgcgcccgcgccaccgggaac
ccggccgtgttctggctggacgagggccgcgcgcacgacgccaacctgatcgccaaggtg
aacgcgtacctgcccgagcacgacaccgacgggctgcgcatcgagatcatgacgccggtc
gaggcgatcgcgttctcgctggagcgcatccggcgcggcgaggacaccatctcggtcacc
ggcaatgtcctgcgtgactacctgacggacctcttcccgatcctggagctcggtacgagc
gccaagatgctctcggtggtgccgctcatcaacggcggcgggctcttcgagaccggtgcg
ggcggctcggccccgaagcacgtgcagcagctcgtcaaggaggactacctgcgctgggac
agcctgggcgagttcctcgcgctggccgtcagcttcgagcacctggcgacgacgacgggc
aacgcgcgggcgcaggtgctggccgacacgctcgaccgcgccaccggcacgttcctgagc
gagaacaagtcgcccagccgcaaggtcggcgggatcgacaaccgtggcagccacttctac
ctggcgctctactgggcccaggagctggcgaagcagaccgaggacacccagctcgccggc
gcgttcacggctctcgccgagacgctcgccgagcaggagcggacgatcgtggacgaactg
atcgccgtgcagggctcgccggtcgacatcggcggttactaccagccggacccggccaag
gccgaggccgtgatgcggccgtcgaagacgttcaaccaggcgatctcgacgctgggttga

DBGET integrated database retrieval system