KEGG   Streptococcus pneumoniae OXC141: SPNOXC09790Help
Entry
SPNOXC09790       CDS       T02074                                 

Gene name
ppc
Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
snx  Streptococcus pneumoniae OXC141
Pathway
snx00620  Pyruvate metabolism
snx00680  Methane metabolism
snx01100  Metabolic pathways
snx01120  Microbial metabolism in diverse environments
snx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:snx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPNOXC09790 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SPNOXC09790 (ppc)
Enzymes [BR:snx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SPNOXC09790 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CBW32635
LinkDB All DBs
Position
984147..986843
Genome map
AA seq 898 aa AA seqDB search
MSLQKLENYSNKSVVKEEVLILTELLEDITKNMLAPETFEKIIQLKELSTQEDYQGLNRL
VTSLSNDEMVYISRYFSILPLLINISEDVDLAYEINHQNNIDQDYLGKLSTTIKLVAEKE
NAVEILEHLNVVPVLTAHPTQVQRKSMLDLTNHIHSLLRKYRDVKLGLINKDKWHNDLRR
YIEIIMQTDMIREKKLKVTNEITNAMEYYNSSFLKAVPHLTTEYKRLAQAHGLNLKQAKP
ITMGMWIGGDRDGNPFVTAKTLKQSALTQCEVIMNYYDKKIYQLYREFSLSTSIVNVSKQ
VREMARQSKDNSIYREKELYRRALFDIQSKIQATKTYLIEDEEVGTRYETANDFYKDLIA
IRDSLLENKGESLISGDFVELLQAVEIFGFYLASIDMRQDSSVYEACVAELLKSAGIHSR
YSELSEEEKCDLLLKELEEDPRILSATHAEKSELLAKELAIFKTARVLKDKLGDDVIRQT
IISHATSLSDMLELAILLKEVGLVDTERARVQIVPLFETIEDLDHSEETMRKYLSLSLAK
KWIDSRNNYQEIMLGYSDSNKDGGYLSSCWTLYKAQQQLTAIGDEFGVKVTFFHGRGGTV
GRGGGPTYEAITSQPLKSIKDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSAAINRMITQ
KKSDTNTPNRYEAIMDQVVDRSYDIYRDLVFGNEHFYDYFFESSPIKAISSFNIGSRPAA
RKTITEIGGLRAIPWVFSWSQSRVMFPGWYGVGSSFKEFINKNPENIAILRDMYQNWPFF
QSLLSNVDMVLSKSNMNIAFEYAKLCEDEQVKAIYETILNEWQVTKNVILAIEGHDELLA
DNPYLKASLDYRMPYFNILNYIQLELIKRQRRGELSSDQERLIHITINGIATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttcaaaaattagaaaattatagtaataaaagtgttgtgaaagaagaagtcttg
attctaacagaattactggaagatattactaaaaatatgcttgccccagagacctttgaa
aaaataatacagttgaaagaattatcaacgcaggaagattatcaaggtctaaaccgtcta
gtgactagcttatcaaatgatgaaatggtctatatttcacgctatttctctatcttacct
cttttgattaatatttcagaggatgtggatttagcttatgaaatcaatcatcaaaataat
attgatcaggactatttaggtaaattatctacaacgattaaattggtagcagaaaaggaa
aatgccgttgagatcctagaacacttgaatgttgtccctgtgttgacagcccatccaaca
caagtgcaacgcaaaagtatgttggatttaacaaatcatattcatagtcttttgcgtaaa
taccgtgatgttaagttggggttaatcaataaagataaatggcacaatgatttgcgtcgt
tacatcgaaattatcatgcagacagacatgattcgtgagaaaaaattaaaagtgactaac
gaaatcacgaatgctatggaatattacaacagctcctttttgaaagctgtccctcatttg
acgacggagtataagcgcttagcgcaagcgcatggtctgaatttaaaacaggctaaacca
atcaccatgggtatgtggataggtggtgaccgtgatggaaatccatttgttacagcaaag
accttgaagcagtctgcactcactcagtgtgaagtcatcatgaactactatgataaaaag
atttaccaactttatcgtgaattttctctttcaactagcattgtcaacgtcagcaagcaa
gtcagagaaatggctcgtcaatccaaggataactcgatttaccgcgaaaaagagctttac
cgtcgtgccttgtttgatattcaatcaaaaattcaggcaactaaaacctatctgattgag
gatgaagaagttgggactcgttatgaaaccgccaatgatttctacaaggatttgattgcc
attcgagattctctactagaaaataagggtgagtccttgatttcaggtgattttgtggaa
ttattgcaggcagtagagatatttggtttttacttagcgtcaattgatatgcgacaagac
tctagcgtctatgaagcctgtgtggcagaactcttgaaatcagcaggaattcattctcgt
tatagcgagttgagcgaagaagaaaagtgtgaccttctcttgaaagaattagaagaagat
ccccgaattctttctgcgactcacgcagaaaaatcagaattattagcaaaagaattagct
atttttaagacggctcgtgttttgaaagataagttgggagatgatgtcatccgtcagacc
atcatttcacatgcaaccagcctttctgatatgctagaattagctattctgttaaaagaa
gtaggactggtggatacggaaagggcgcgtgttcagattgttcccctttttgaaacaatt
gaagacttggatcattcagaggaaacaatgagaaaatatctttctcttagccttgccaaa
aaatggattgactcacgaaataactaccaagaaatcatgcttggctactctgacagtaat
aaagatggcggttacttgtcatcatgttggaccctctacaaggctcaacaacaattgact
gctattggagatgaatttggcgttaaggttaccttcttccatggtcgtggtggtactgtc
ggtcgtggtggtgggccaacctatgaagccattacatctcaaccgctcaagtctatcaag
gatcgtatccgcttgacggagcagggtgaagtaattgggaataaatacggtaacaaagac
gccgcttactataaccttgaaatgctagtatcggcagctattaaccgtatgattactcag
aagaagagcgataccaataccccaaatcgttatgaagccattatggatcaagtagtggac
cgtagttacgatatctaccgtgatttggtctttggtaatgagcatttctatgattatttc
ttcgagtcaagtccaatcaaggctatttcaagttttaatattggttctcgtccagccgct
cgtaagactattactgaaatcggtggattgcgtgccatcccttgggtattctcatggtca
cagagtcgtgttatgttccctggatggtacggggttggttcaagcttcaaggaatttatc
aataaaaatccagagaatattgctatcttacgagatatgtaccaaaattggcctttcttc
caatcgcttctttcaaatgttgatatggttttgtcaaaatcaaatatgaatattgctttt
gaatatgctaaactttgtgaagacgagcaagttaaggccatctatgagactattttaaat
gaatggcaagttactaagaacgttatcttggctattgaaggacatgacgaactcttagct
gacaatccatatctaaaagctagtctggattaccgtatgccttactttaatattctcaac
tatattcagttagagttgattaaacgccaacgtcgtggagaattgtccagtgatcaagaa
cgattgattcatatcaccatcaacggaattgcgacaggattgcgtaattcaggttga

DBGET integrated database retrieval system