KEGG   Streptococcus pneumoniae OXC141 (serotype 3): SPNOXC19280Help
Entry
SPNOXC19280       CDS       T02074                                 

Gene name
glpO
Definition
(GenBank) alpha-glycerophosphate oxidase
  KO
K00105  alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
snx  Streptococcus pneumoniae OXC141 (serotype 3)
Pathway
snx00564  Glycerophospholipid metabolism
snx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPNOXC19280 (glpO)
Enzymes [BR:snx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     SPNOXC19280 (glpO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBW33580
LinkDB All DBs
Position
complement(1979855..1981681)
Genome map
AA seq 608 aa AA seqDB search
MEFSKKTRELSIKKMQERTLDLLIIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEDGATFSLFRL
KVAMDLYDLLAGVSNTPTANKVLSKDQVLERQPNLKKEGLVGGGVYLDFRNNDARLVIEN
IKRANQDGALIANHVKAEGFLFDESGKITGVVARDLLTDQVFEIKARLVINTTGPWSDKV
RNLSNKGTQFSQMRPTKGVHLVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRENKTYFGTT
DTDYTGDLEHPKVTQEDVDYLLGIVNNRFPESNITIDDIESSWAGLRPLIAGNSASDYNG
GNNGTISDESFDNLIATVESYLSKEKTREDVESAVSKLESSTSEKHLDPSAVSRGSSLDR
DDNGLLTLAGGKITDYRKMAEGAMERVVDILKAEFDRSFKLINSKTYPVSGGELNPANVD
SEIEAFAQLGVSRGLDSKEAHYLANLYGSNAPKVFALAHSLEQAPGLSLADTLSLHYAMR
NELALSPVDFLLRRTNHMLFMRDSLDSIVEPVLDEMGRFYDWTEEEKATYRADVEAALAN
NDLAELKN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaagaaaacacgtgaattgtcaattaaaaaaatgcaggaacgcaccctg
gacctcttgattatcggtggaggaatcacaggagctggtgtagccttgcaggcggcagct
agcggtcttgagactggtttgattgaaatgcaagactttgcagaaggaacatctagtcgt
tcaacaaaattggttcacggaggtcttcgctacctcaaacaatttgacgtagaagtggtc
tcagatacggtttctgaacgtgcagtggttcaacaaatcgctccacacattccaaaacca
gatccaatgctcttaccagtttacgatgaagatggagcaacctttagcctcttccgtctt
aaagtagccatggacttgtacgaccttttagcaggtgtgagcaacacaccaactgcgaac
aaggttttgagcaaggatcaagtcttggaacgccagccaaacttgaagaaggaaggcttg
gtaggaggtggagtgtatcttgacttccgtaacaacgatgcgcgtctcgtgattgaaaac
atcaaacgtgccaaccaagacggtgccctcattgccaaccacgtgaaggcagaaggcttc
ctctttgacgaaagtggcaagattacaggtgttgtagctcgtgatctcttgacagaccaa
gtatttgaaatcaaggcccgtctggttattaatacaacaggtccttggagtgataaagta
cgtaatttgtctaataagggaacgcaattctcacaaatgcgcccaactaagggagttcac
ttggtagtggattcaagcaaaatcaaggtttcacagccagtttactttgacacaggtttg
ggtgacggtcgtatggtctttgttctcccacgtgaaaacaagacttactttggtacaact
gatacagactacacaggtgatttggagcatccaaaagtaactcaagaagatgtagattat
ctacttggcattgtcaacaaccgctttccagaatccaacatcaccattgatgatatcgaa
agcagctgggcaggtcttcgtccattgattgcagggaacagtgcctctgactataatggt
ggaaataacggtaccatcagtgatgaaagctttgacaacttgattgcgactgttgaatct
tatctctccaaagaaaaaacacgtgaagatgttgagtctgctgtcagcaagcttgaaagt
agcacatctgagaaacatttggatccatctgcagtttctcgtgggtctagcttggaccgt
gatgacaatggtcttttgactcttgctggcggtaaaatcacagactaccgtaagatggct
gaaggagctatggagcgcgtggttgacatcctcaaagcagaatttgaccgtagctttaaa
ttgatcaattctaaaacttaccctgtttcaggtggagaattgaacccagcaaatgtggat
tcagaaatcgaagcctttgcgcaacttggagtatcacgtggtttggatagcaaggaagct
cactatctggcaaatctttacggttcaaatgcaccgaaagtctttgcacttgctcacagc
ttggaacaagcgccaggactcagcttggcagatactttgtcccttcactatgcaatgcgc
aatgagctagctcttagcccagttgacttccttcttcgtcgtaccaaccatatgctcttt
atgcgtgatagcttggatagcatcgttgagccagttttggatgaaatgggacgattctat
gactggacagaagaagaaaaagcaacttaccgtgctgatgtcgaagcagctctcgctaac
aacgatttagcagaattaaaaaattaa

DBGET integrated database retrieval system