KEGG   Streptomyces nigra: DC008_01445Help
Entry
DC008_01445       CDS       T05839                                 

Definition
(GenBank) alkene reductase
  KO
K10680  N-ethylmaleimide reductase [EC:1.-.-.-]
Organism
snz  Streptomyces nigra
Pathway
snz00633  Nitrotoluene degradation
snz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:snz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DC008_01445
Enzymes [BR:snz01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     DC008_01445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN
Motif
Other DBs
NCBI-ProteinID: AWE48500
UniProt: A0A2S1I7A4
LinkDB All DBs
Position
309495..310622
Genome map
AA seq 375 aa AA seqDB search
MSDQTPAPATTQPLLRPVRLGALELPNRVVMAPMTRARAANPELTPTDLHATYYTQRASA
GLLISEGTWVNPDAIGYIHVPGIYTDAQTAGWAQVTDAVHAAGGRIVSQIGHLGAVSHPD
HQGGRLPVGPSAVNPQEMSFTPDGPKATVTPRALTSAEIADTIRSYRQAAANARRAGFDG
LEIHAQGSHLIAQFLNPRLNQRTDAYGGTSEKRAQLLLDLVDAVSDVWGGERVGVKLSPY
WNGGPTFTADADTLADYDLLLKRLDDSDLAYLHLVGPAPGSDTDDTLTAFSRFRSHYGGS
VIANLGFTQATGNDLLERRLADAVSFGAPFIANPDLVERFTHGHPLAEGDRDTYYAGGVK
GYTDYPAVTGSQHGR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccagaccccggcccccgccaccacccagcccctcctgcgccccgtccgtctg
ggcgcgctcgaactgcccaaccgggtcgtcatggcacccatgacccgcgcccgggccgcc
aaccccgagctgacccccaccgatctgcacgccacctactacacccagcgcgcgagcgcc
ggtctgctcatcagcgaggggacctgggtcaacccggacgcgatcggctacatccacgtc
cccggcatctacaccgacgcccagaccgccggctgggcccaggtcaccgacgccgtgcac
gcggcgggaggccggatcgtctcccagatcggccatctcggcgcggtctcgcacccggac
caccagggcggccgtctccccgtcggcccctcggccgtcaacccccaggagatgtccttc
accccggacggcccgaaggccaccgtcacgccccgcgccctgacgagcgcggagatcgcg
gacacgatccgcagctaccggcaggccgccgccaacgcccggcgcgccgggttcgacggc
ctggagatccacgcgcaggggtcccatctcatcgcccagttcctcaacccccgcctcaac
cagcgcaccgacgcctacggcggcaccagtgagaagcgcgcccagctcctcctcgacctc
gtggacgcggtgagcgacgtgtggggcggcgagcgggtcggcgtcaagctctccccgtac
tggaacggcgggcccaccttcacggcggacgccgacacactggccgactacgacctgctg
ctgaagcgcctcgacgacagcgacctggcctacctccacctcgtcggcccggcccccggc
tcggacaccgacgacaccctcaccgcgttcagccgattccgctcccactacggcggctcc
gtcatcgccaacctcggcttcacccaggcgaccggcaacgacctcctcgaacggcggctc
gccgacgcggtgtccttcggcgcccccttcatcgccaatccggacctcgtcgagcgcttc
acacacggacaccccctcgccgagggcgaccgcgacacgtactacgccggtggagtgaag
gggtacacggactacccggccgtgaccggctcccagcacggccgttga

DBGET integrated database retrieval system