Streptomyces nigra: DC008_03445 Help Entry DC008_03445       CDS       T05839                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism snz  Streptomyces nigra Pathway snz00261   Monobactam biosynthesis snz01100   Metabolic pathways snz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DC008_03445  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snz01008]     DC008_03445 Polyketide biosynthesis proteins [BR:snz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DC008_03445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AWE48851 UniProt:  A0A2S1I873 LinkDB All DBs Position complement(745591..745800) Genome browser AA seq 69 aa AA seqDB search MSTNPFDDDEGRFLVLVNDEGQHSLWPSFAEVPGGWAAVFGEDSRRACLDYVDTHWTDLR PRSLARVQD NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacgacgagggccgcttcctggtcctggtgaacgacgag ggccagcactcgctgtggccgtccttcgccgaggtgcccggagggtgggcggccgtgttc ggggaggactcccggcgggcgtgcctggactacgtcgacacgcactggaccgatctgcgg ccccggtccctcgcgcgggtccaggattag

DBGET integrated database retrieval system