KEGG   Streptomyces nigra: DC008_12480Help
Entry
DC008_12480       CDS       T05839                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
snz  Streptomyces nigra
Pathway
snz00970  Aminoacyl-tRNA biosynthesis
snz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DC008_12480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:snz03029]
    DC008_12480
Enzymes [BR:snz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DC008_12480
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DC008_12480
Mitochondrial biogenesis [BR:snz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DC008_12480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AWE50456
UniProt: A0A2S1ID26
LinkDB All DBs
Position
2706788..2708221
Genome map
AA seq 477 aa AA seqDB search
MTDLAGLTAAQLLDGYRTGRFDPVDATRAALERAERIQPRVNAFVRLTAEEALARAGESA
LRWRRGTPAGPLDGVPVTVKDILLTRGVPTLRGSRTVQEHGRWDEDAPSVARLRERGAVF
LGKTTTPEFGWKGVTDSPLSGVTRNPYDLSRTAGGSSGGAAAAVALGAGPLALGTDGGGS
VRIPAAFCGVFGLKPTYGRVPLYPASAFGSLAHVGPLTRDAADAALMLDAIGVPDPRDGS
ALPAAPGSFVAALEGGVRGLRVAYSPSLGGQVAVRPAVATAVRRAVERLAHLGAYVEERD
PDFTDPVEAFHTLWFSGAARVVQRLGPRERALLDPGLREICALGARYSALDYLTAMDVRR
DLGRRMGRFHTTYDLLVTPTLPVTAFEAGAEVPKGSGHRRWTGWTPFTYPINMTQQPAAS
VPVGTDAEGLPVGLQLVAARHRDDLVLRAAHALYEAGVAGVPAPPAAPGRSEPAEAQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacggatctcgccggactgaccgccgcacaactgctcgacggataccggaccgggcgg
ttcgacccggtggacgccacccgcgcggcgctggagcgggccgagcggattcagccacgg
gtcaacgcgttcgtccggctgaccgccgaggaggccctcgcgcgggccggggagtccgcg
ctgcggtggcggcgcggcaccccggccgggccgctcgacggggtgccggtcacggtgaag
gacatcctgctgacgcggggcgtgccgacgctgcggggttcccggaccgtgcaggagcac
ggccgctgggacgaggacgcgccgtccgtggcccggctgcgggagcggggcgcggtgttc
ctcggcaagacgacgacgcccgagttcggctggaagggcgtcaccgactcgccgctgtcc
ggcgtcacccgcaacccctacgacctgtcccggacggcgggcggttccagcgggggcgcc
gccgcggccgtggcgctgggcgcggggccgctcgccctgggcaccgacggcggcggcagc
gtccgtatcccggcggccttctgcggtgtcttcgggctgaaaccgacgtacgggagggtc
ccgctgtacccggcgagcgccttcggctcgctcgcgcacgtcggcccgctgacccgggac
gcggccgacgcggcgctgatgctcgacgccatcggggtgcccgacccccgtgacgggtcg
gcgctcccggcggcgcccggctccttcgtggcggctctggagggcggggtgcggggcctg
cgggtcgcgtactcgccgtccctgggcggtcaggtggcggtgcgtccggcggtggcgacg
gcggtgcggcgggcggtggagcggctggcgcacctcggggcgtacgtggaggagcgggac
ccggacttcaccgatccggtggaggcgttccacaccctgtggttctcgggggcggcccgg
gtcgtgcagcgcctcggaccgcgcgagcgcgccctcctggaccccgggctgcgggagatc
tgcgccctcggcgcccggtacagcgcgctcgactatctgaccgcgatggatgtgcgccgg
gacctcggccgccggatgggccgcttccacacgacgtacgacctgctggtcacacccacc
ctgccggtcacggcgttcgaggcgggcgcggaggtgccgaaggggtccgggcaccggcgg
tggacgggctggacgccgttcacctaccccatcaacatgacccagcagcccgccgcgtcg
gtcccggtcggcaccgacgccgaaggcctgccggtggggctgcaactcgtggccgcccgg
caccgggacgacctggtgctgcgcgcggcgcacgccctgtacgaggcgggggtcgccggt
gtgcccgcgccgcccgccgcgcccggccggtcagagcccgcggaagcgcagtga

DBGET integrated database retrieval system