KEGG   Streptomyces nigra: DC008_22570Help
Entry
DC008_22570       CDS       T05839                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
snz  Streptomyces nigra
Pathway
snz00020  Citrate cycle (TCA cycle)
snz00190  Oxidative phosphorylation
snz00650  Butanoate metabolism
snz01100  Metabolic pathways
snz01110  Biosynthesis of secondary metabolites
snz01120  Microbial metabolism in diverse environments
snz01130  Biosynthesis of antibiotics
snz01200  Carbon metabolism
Module
snz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
snz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
snz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:snz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DC008_22570
   00650 Butanoate metabolism
    DC008_22570
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DC008_22570
Enzymes [BR:snz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DC008_22570
    1.3.5.4  fumarate reductase (quinol)
     DC008_22570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_7 Fer4_9 DUF1126 Fer4_10
Motif
Other DBs
NCBI-ProteinID: AWE52200
UniProt: A0A2S1IHU9
LinkDB All DBs
Position
complement(4840629..4841399)
Genome map
AA seq 256 aa AA seqDB search
MSSYEARFKVWRGDVGGGDLEDFRVEVNDGEVVLDIIHRLQATQAPDLAVRWNCKAGKCG
SCSAEINGRPRLMCMTRMSVFDREETITVTPLRAFPVVRDLVTDVGFNYEKARQVPAFVP
PEGVGPGEYRMMQEDVDRSQEFRKCIECFLCQDTCHVVRDHEENKPAFAGPRFLMRVAEL
DMHPLDAAAESGLDRKRTAQDEHGLGYCNITKCCTEVCPEGIRITDNALIPLKERAVDRK
YDPLVWLGSKIRRRTS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagctacgaggcccgcttcaaggtgtggcgcggcgatgtcgggggcggggacctg
gaggacttccgggtcgaggtgaacgacggcgaggtcgtcctcgacatcatccaccgcctc
caggccacccaggcgcccgatctggccgtccgctggaactgcaaggcgggcaagtgcggg
tcgtgctccgccgagatcaacgggcggccccggctgatgtgcatgacccggatgtcggtg
ttcgaccgcgaggagacgatcacggtcaccccgctgcgggccttccccgtcgtacgggac
ctggtcacggacgtcggcttcaactacgagaaggcccggcaggtcccggccttcgtgccg
ccggagggcgtggggcccggcgagtaccggatgatgcaggaggacgtggaccgctcgcag
gagttccgcaagtgcatcgagtgcttcctgtgccaggacacctgccatgtggtgcgcgac
cacgaggagaacaaaccggccttcgccggtccccgcttcctcatgcgcgtcgccgagctg
gacatgcacccgctggacgcggcggccgagagcggactcgaccgcaagagaacagcgcag
gacgagcacgggctcgggtactgcaacatcaccaagtgctgcaccgaggtctgccccgag
ggcatcaggatcacggacaacgcgctgatcccgctgaaggaacgggccgtggaccgcaag
tacgacccgctggtgtggctggggtcgaagatcagaaggcggacctcgtag

DBGET integrated database retrieval system