KEGG   Streptomyces nigra: DC008_22575Help
Entry
DC008_22575       CDS       T05839                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
snz  Streptomyces nigra
Pathway
snz00020  Citrate cycle (TCA cycle)
snz00190  Oxidative phosphorylation
snz00650  Butanoate metabolism
snz01100  Metabolic pathways
snz01110  Biosynthesis of secondary metabolites
snz01120  Microbial metabolism in diverse environments
snz01130  Biosynthesis of antibiotics
snz01200  Carbon metabolism
Module
snz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
snz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
snz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:snz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DC008_22575
   00650 Butanoate metabolism
    DC008_22575
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DC008_22575
Enzymes [BR:snz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DC008_22575
    1.3.5.4  fumarate reductase (quinol)
     DC008_22575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like FAD_oxidored GIDA Thi4 FAD_binding_3 Pyr_redox_3 RHSP Lycopene_cycl AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AWE52201
UniProt: A0A2S1IHV1
LinkDB All DBs
Position
complement(4841396..4843339)
Genome map
AA seq 647 aa AA seqDB search
MSVVDRQEWDVVVVGAGGAGLRAAIEARERGARTAVICKSLFGKAHTVMAEGGIAAAMAN
ANEHDNWKVHFRDTMRGGKFLNQWRMAELHAQEAPQRVWELETWGALFDRTKDGRISQRN
FGGHEYPRLAHVGDRTGLELIRTLQQKIVSLQQEDKKETGDYESRLKVYQECTVTRILKD
GRRVSGVFAYERETGRFFVLEAPSVVIATGGIGKSFKVTSNSWEYTGDGHALALLAGAPL
LNMEFVQFHPTGMVWPPSVKGILVTESVRGDGGVLRNSEGKRFMFDYVPDVFKEKYAESE
EEGDRWYEDPDNNRRPPELLPRDEVARAINAEVKAGRGSPHGGVFLDVSTRMPAEVIKRR
LPSMYHQFKELADVDITAEPMEVGPTCHYVMGGIAVDSDTAAARGVPGLFAAGEVAGGMH
GSNRLGGNSLSDLLVFGRRAGWHAAEHAAAQAFERPGVSDPQIDSAAAEALRPFSAEGPA
GSVDAGRPPENPYTLHQELQQAMNDLVGIIRREAEMEQALEKLAELRVRAHRAGVEGHRQ
FNPGWHLALDLRNMLLVSECVARAALERTESRGGHTREDHPEMDRRWRNVNLLCRLADPT
GGLAATDPESGQIDLVRETTEPVRQDLLALFEKEELVKYLAEEELYQ
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtggtcgaccggcaggagtgggacgtcgtcgtggtcggtgccgggggcgccggc
ctccgcgcggcgatcgaggcacgggagcggggcgcccgtacagccgtgatctgcaagtcg
ctgttcggcaaggcgcacaccgtgatggccgagggcggtatcgcggcggccatggccaac
gccaacgagcacgacaactggaaggtgcacttccgcgacaccatgcgcggcggcaagttc
ctcaaccagtggcggatggccgagctgcacgcccaggaggcgccgcagcgggtgtgggag
ctggagacctggggcgcgctcttcgaccggacgaaggacggccggatctcgcagcgcaac
ttcggcgggcacgagtacccgcgtctcgcgcacgtcggcgaccgcaccggtctggagctg
atccgcaccctccagcagaagatcgtctccctccagcaggaggacaagaaggagaccggg
gactacgagtcccggctgaaggtctatcaggagtgcacggtcacccggatcctcaaggac
ggccgccgcgtctccggggtcttcgcctacgagcgggagaccggccgcttcttcgtcctg
gaggccccgtccgtggtcatcgcgaccggcggcatcggcaagtccttcaaggtgacgtcg
aactcctgggagtacacgggcgacgggcacgcgctcgcgctgctcgccggggcgccgctg
ctcaacatggagttcgtgcagttccatccgacgggcatggtctggccgccgtccgtgaag
ggcatcctggtcaccgagtcggtgcgcggcgacggcggggtgctgcgcaactccgagggc
aagcggttcatgttcgactacgtcccggacgtcttcaaggagaagtacgccgagtcggag
gaggagggcgaccgctggtacgaggacccggacaacaaccggcgccctcccgagctgctc
ccccgcgacgaggtggcccgcgcgatcaacgccgaggtgaaggcgggccggggctcgccg
cacggcggggtcttcctggacgtgtccacccggatgccggcggaggtcatcaagcgccgg
ctgccgtcgatgtaccaccagttcaaggagctggcggacgtcgacatcaccgccgagccg
atggaggtcgggccgacctgccactacgtcatgggcggtatcgcggtcgactcggacacg
gcggcggcccgcggggtgccggggctgttcgctgccggtgaggtcgccggcgggatgcac
ggctccaatcggctcggcggcaactcgctctccgacctgctggtcttcggccgccgggcg
ggctggcacgccgccgagcacgcggcggcgcaggcgttcgagcgccctggcgtcagcgac
ccccagatcgacagcgcggcggcggaggcgctgcggcccttctcggcggagggcccggcc
gggtccgtggacgccggacggccgccggagaacccgtacaccctgcaccaggagctccag
caggccatgaacgacctggtcggcatcatccggcgcgaggccgagatggagcaggcgctg
gagaagctcgccgagctgcgggtacgggcccaccgggccggggtcgaggggcaccggcag
ttcaacccgggctggcacctcgcgctggacctgcggaacatgctgctggtcagcgagtgc
gtggcgcgggcggcgctggagcgcaccgagtcccgcggcggccacacccgtgaggaccat
ccggagatggaccgccgctggcgcaacgtcaacctgctgtgccggctggccgacccgacg
ggcggcctcgcggccaccgaccccgagagcggccagatcgacctcgtccgggagaccacc
gaacccgtccgccaggacctgctcgccctcttcgagaaggaggagctggtcaagtacctc
gccgaagaggagctctaccagtga

DBGET integrated database retrieval system