KEGG   Streptomyces nigra: DC008_23385Help
Entry
DC008_23385       CDS       T05839                                 

Gene name
sodN
Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
snz  Streptomyces nigra
Brite
KEGG Orthology (KO) [BR:snz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DC008_23385 (sodN)
Enzymes [BR:snz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DC008_23385 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: AWE52346
UniProt: A0A2S1IIA1
LinkDB All DBs
Position
complement(5012963..5013358)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAANDDPHFQARATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDALKALSAAKASTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcaaggtcagcgcacactgcgacctgccctgc
ggtgtgtacgacccggcccaggcccgcatcgaggcggagtcggtgaaggccgtccaggaa
aagatggccgccaacgacgacccgcacttccaggcgcgtgccaccgtcatcaaggagcag
cgcgccgagctggccaagcaccacgtctcggtgctctggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacgccctgaaggccctctcg
gccgccaaggcgtcgacggacccggcgacgggccagaaggctctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system