KEGG   Streptomyces nigra: DC008_29415Help
Entry
DC008_29415       CDS       T05839                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
snz  Streptomyces nigra
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AWE53400
UniProt: A0A2S1ILC5
LinkDB All DBs
Position
complement(6395640..6396710)
Genome map
AA seq 356 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMQYEAKWDGFRAIVFRDGDEIELSSRTTKPLTRYFPE
LATALKERLPERCVVDGEIVIAREGRLDFDALTERIHPADSRVRTLAERTPASFVAFDLL
ALDDASLMRAPLTERREQLTSALSGVTAPVHVAPATTDIETARGWFEQYEGAGLDGVVAK
PLTLRYLPDERAMYKIKHERTADVVVAGYRLHKSGPVVGSLLLGLYDDRGALQHVGVSAA
FPMKRRAELIDELEPLRMDDVSGHPWAAWAEEAAHESARLPGAPSRWSGKKDLSWVPLRP
ERVAEVAYDHMENGARFRHTARFRRWRPDRTPSSCTYEQLEEPVRYDLAEIFAPPT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccggtgatgccgcccgtgaagccgatgctcgccaagtcggtggcgaagatc
ccgccgggcatgcagtacgaggcgaagtgggacggcttccgggcgatcgtgttccgcgac
ggggacgagatcgagctcagcagccgtaccaccaaacctctgaccaggtacttccccgag
ctggcgacagcgctgaaggagcggctgcccgagcggtgcgtggtggacggggagatcgtg
atcgcccgggaggggcggctggacttcgacgcgctcaccgagcgcatccacccggcggac
tcccgggtgcgcacgctggcagagcggaccccggcgtctttcgtggcgttcgacctgctg
gcactggacgacgcgtccctgatgcgggcgcccctgacggagcgcagggagcagctgacg
tcggcgctgtccggggtgacggcacccgtgcacgtggcgccggcgacgaccgacatcgag
acggcccgggggtggttcgagcagtacgagggggccggtctcgacggggtcgtcgccaag
ccgctcaccctgcgctatctgcccgacgaacgcgccatgtacaagatcaagcacgagcgg
acggcggacgtcgtcgtcgccggctaccgcctgcacaagagcggcccggtcgtcggctcg
ctgctgctcggcctgtacgacgaccggggcgccctgcagcatgtgggggtgtcggcggcg
ttcccgatgaagcggcgggccgagctgatcgacgagctggagccgctgcggatggacgac
gtctccgggcacccgtgggcggcctgggccgaggaggcggcccatgagtcggcccggctg
ccgggggcgccgagccgctggtcgggcaagaaggacctgtcctgggtgccgctgcggccg
gagcgggtcgccgaggtggcgtacgaccacatggagaacggcgcccggttccggcacacg
gcccgcttccgccgctggcgcccggaccgcaccccctccagctgcacgtacgagcagctg
gaggagccggtgcgctacgacctcgcggagatcttcgcgccgccgacgtga

DBGET integrated database retrieval system