KEGG   Solibacillus sp. R5-41: CSE16_02950Help
Entry
CSE16_02950       CDS       T05144                                 

Gene name
flgM
Definition
(GenBank) flagellar biosynthesis anti-sigma factor FlgM
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
sob  Solibacillus sp. R5-41
Pathway
sob02020  Two-component system
sob02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:sob00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CSE16_02950 (flgM)
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    CSE16_02950 (flgM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:sob02035]
    CSE16_02950 (flgM)
Bacterial motility proteins [BR:sob02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    CSE16_02950 (flgM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM DUF3821 DUF327
Motif
Other DBs
NCBI-ProteinID: ATP39065
UniProt: A0A2D1SPN0
LinkDB All DBs
Position
650778..651038
Genome map
AA seq 86 aa AA seqDB search
MKINPIGIQAINSYKNQARSVNNPKTNQSFADQIEISLKAKEMQGTSTYANERADRVQKL
KEEIQSGTYKVDARQVAEDMLKYYRR
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaatccaattggcatccaggcaatcaattcttataaaaatcaagcgcgctcg
gtaaataatccgaaaacaaatcaatcttttgcagatcaaattgagatttcgttaaaagca
aaagaaatgcaaggcacatctacttatgcaaatgaacgagcagatcgcgtgcaaaagtta
aaagaagaaattcaatcaggcacttataaagtcgatgcacgtcaagtagcagaagatatg
ttgaaatactatcgccgttaa

DBGET integrated database retrieval system