KEGG   Solibacillus sp. R5-41: CSE16_17805Help
Entry
CSE16_17805       CDS       T05144                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
sob  Solibacillus sp. R5-41
Pathway
sob00340  Histidine metabolism
sob01100  Metabolic pathways
sob01110  Biosynthesis of secondary metabolites
sob01230  Biosynthesis of amino acids
Module
sob_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sob00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CSE16_17805
Enzymes [BR:sob01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     CSE16_17805
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     CSE16_17805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ATP41736
UniProt: A0A2D1SXD6
LinkDB All DBs
Position
complement(3615485..3616105)
Genome map
AA seq 206 aa AA seqDB search
MNVKFNEQGLVPVVVQNAQSKEILTVANMNEESLAKTIETGETWFFSRSRAELWHKGATS
GNTQQVVSIKTDCDQDALVVEVIPAGPACHNGTTSCFTESIVENSRSGSVGILPKLVEII
KQRENDMPEGAYTTYLFDKGIDKICKKVGEEATEVVIGAKNRDKEEVKWESADLLYHLLV
LLQEQKVDIYEVLEVLQKRHEGNLQI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaaatttaatgaacaaggcttagttcctgtcgttgtccagaatgcacaatca
aaagaaatattaacagtagctaatatgaatgaagaatctttagcgaaaacgattgaaaca
ggcgagacatggtttttttctcgttcacgcgcagagctttggcataaaggtgcaacgagc
ggaaatactcagcaagttgtctccattaaaactgattgtgaccaagatgcgcttgttgta
gaagtgattcctgctggaccagcttgtcacaacggaacaacgtcgtgctttacagaaagc
atcgttgaaaattcacgttcaggctcagtgggcattttaccgaagcttgtagaaattatt
aagcaacgtgaaaatgatatgccagaaggtgcatacacaacgtatttattcgataaaggc
atcgataaaatttgtaaaaaggttggggaagaggcaacagaggttgtcattggtgccaaa
aaccgcgacaaagaagaagtgaagtgggaatccgccgatcttttatatcaccttttagta
ttgcttcaagagcaaaaagttgatatttacgaagtgctagaagttttacaaaagcggcat
gaggggaacctccaaatttaa

DBGET integrated database retrieval system