KEGG   Solibacillus sp. R5-41: CSE16_19670Help
Entry
CSE16_19670       CDS       T05144                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sob  Solibacillus sp. R5-41
Pathway
sob00473  D-Alanine metabolism
sob00550  Peptidoglycan biosynthesis
sob01100  Metabolic pathways
sob01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sob00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CSE16_19670
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CSE16_19670
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CSE16_19670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sob01011]
    CSE16_19670
Enzymes [BR:sob01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CSE16_19670
Peptidoglycan biosynthesis and degradation proteins [BR:sob01011]
 Precursor biosynthesis
  Amino acid ligase
   CSE16_19670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ATP42050
UniProt: A0A2D1SY88
LinkDB All DBs
Position
complement(3996334..3997407)
Genome map
AA seq 357 aa AA seqDB search
MKKRIGLLYGGKSAEHEVSLSTAQAVTQALNFNEYDVYPIFITLDGEWRVGPRLIEPAQS
PEQLQFKSMADHSANNIIQFIEAHTKNPFDVVFPLLHGTNGEDGTVQGFLDVLNIPYVGN
GVLSSAAGMDKVVMKQLFEMADLPQLPYVYFIRSEWEGDRSQWVEKCERKLGYPMFVKPA
NLGSSVGISKATNIQELEKAVQFALQYDRKIVVEQGVIAREIELAVLGNDTPEVSVAGEI
KPVTEFYDYDSKYKDGSTVLIIPAELQGNVYQDLVDMAKKAFKAIDGSGLVRADFFVTAD
NELYINEVNTMPGFTPVSMYPLLWQHTAVTYPQLIDQLIALAIERHTEKQKLQYKRD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaatcggtttattgtatggagggaagtctgcggagcatgaagtatcattg
tcgacggcacaggctgtaacgcaagctttgaattttaatgaatatgatgtatatccgatt
tttattacattggatggcgaatggcgtgtaggacctcgattaatagaaccagcacaatca
cctgaacaattacaatttaaatcaatggcagatcattctgctaataatattatacaattt
atcgaagcgcatacgaaaaatccttttgatgttgtattcccattgttgcatgggacgaat
ggcgaagatggaacggttcaaggatttttggatgttttaaatatcccttacgttggcaat
ggcgtgcttagttcggcggctggaatggataaggttgtgatgaagcaattatttgagatg
gcagatttacctcaattaccatacgtgtatttcattcgtagtgagtgggaaggggatcgt
tcacaatgggtagagaagtgtgagcgaaaacttggctacccgatgttcgttaagccagca
aatttgggctcgagtgtcggaattagtaaagcaacaaatatacaagaattagaaaaggcc
gttcaatttgccctccaatatgaccgtaaaatcgttgtggagcaaggggttattgcccgg
gaaatcgagcttgccgtacttgggaacgacacaccagaagtatcggtagcgggagaaatt
aaaccagtaacggaattttatgattatgattcaaaatataaagatggttcaacggtatta
atcattccagcagaactgcaggggaatgtgtaccaagatttagttgatatggcgaaaaag
gcatttaaagcaattgatggatcaggtttagtacgtgctgacttttttgtgacagctgat
aatgaactatatatcaatgaagtgaacacgatgcctggatttacaccggtaagtatgtac
ccgctattatggcagcatacagctgtaacttatccgcaattaatcgatcaattaattgca
ttagcgatagagcgtcatacggaaaaacaaaaacttcaatacaaaagagattga

DBGET integrated database retrieval system