KEGG   Solibacillus sp. R5-41: CSE16_20030Help
Entry
CSE16_20030       CDS       T05144                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sob  Solibacillus sp. R5-41
Brite
KEGG Orthology (KO) [BR:sob00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CSE16_20030
Enzymes [BR:sob01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CSE16_20030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like FAD_binding_3 AlaDh_PNT_C Lycopene_cycl Glutaredoxin DAO Thi4 Thioredoxin_4 FMO-like NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ATP42115
UniProt: A0A2D1SYE6
LinkDB All DBs
Position
complement(4072207..4073766)
Genome map
AA seq 519 aa AA seqDB search
MLDNQIKAQLQQYLTMLEGDLVLKVSAGDDKVSQNLLELVTELEKMSPRITLEHTILERT
PSFSVNKKGEEDSGVVFAGLPLGHEFTSLVLALLQVSGRAPKVDESVIKRIQAIKEPMHF
ETFVSLTCHNCPDVVQALNIMSVLNPNITHVMVEGGAFQHEVTERDIMAVPTVFANGKNF
AGGRMDIEEILNQIGSKSDGSEFANVEPFDVLVVGGGPAGAAAAIYSARKGIRTGIVSER
FGGQVNDTLSIENIIGTKATEGPAFVSNLEAHVADYAIDVMKSQRAAKIEKKDFVEVTLE
NGAVLKGKAVILSTGARYRQLGVPGEQEFKNKGVAYCPHCDGPIFKGKNIAVIGGGNSGV
EAAIDLAGIVNHVTLLQGSEELTADKVLQERVRSLKNVTVITNAFTQEITGTNKVNGLTY
IDKVTGKEHHVELEGIFVQIGLLPNTEFLQGAITMNAHGEIIVDKHGATNMPGVFAAGDC
TDAAYKQIIISMGSGATAALGAFDYMIRHTSGESELMGV
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagataatcaaattaaagcacaattacaacaatatttaacaatgcttgaaggcgat
ttagtgttaaaggtaagtgcgggagatgataaagtttctcaaaacttgcttgaattagta
acggagcttgagaaaatgtctccacgtattacactcgagcatacaattctagagcgtaca
ccaagttttagtgtgaataaaaaaggtgaagaagattctggtgttgtatttgcaggctta
ccacttggacatgaatttacgtcattagtactagcattactacaagtttcaggtcgtgcg
ccgaaagtagatgaatcggttattaaacgtatacaagcgattaaagagccgatgcatttt
gaaacttttgttagcttgacgtgccacaactgtccagatgttgtacaagcattaaatatt
atgtctgtattaaatccgaatattacgcatgtaatggtcgaaggtggcgcgttccagcat
gaagtaacagagcgtgacattatggctgtaccaactgtatttgcaaatggtaagaacttt
gcaggtggtcgaatggatattgaagaaattttaaatcaaattggtagtaaatcagatggc
tctgaatttgctaacgttgaaccgtttgatgtgttagttgttggtggtggtcctgcggga
gctgcagcggccatttactcagcgcgtaaaggaattcgcacaggaatcgtatcagagcgc
ttcggtgggcaagtaaatgatacattatcaattgagaatattattgggacaaaggcaaca
gaaggcccagcatttgtttcaaacttagaagctcatgttgccgattatgcgatcgatgtg
atgaaatctcagcgtgcagcgaaaattgagaagaaggatttcgtggaagtaacgttagag
aatggcgcggtattaaaagggaaagcagtgatcctttctacaggtgcgcgctaccgtcag
cttggtgtacctggtgagcaagagtttaaaaataaaggtgttgcatactgtccacactgt
gatggtcctatttttaaagggaaaaatattgcggttattggtggcggtaactctggcgtt
gaagcggcaatcgacttagcgggtattgttaaccacgttactttactacaaggcagtgaa
gaactaacagcggataaagttttacaagaacgtgtacgtagcttgaaaaacgtaacggtt
attacgaatgctttcacgcaagaaattacaggtactaataaagtaaacggtttaacatat
atagacaaggttacaggcaaggaacaccatgtagaactagagggtattttcgtccaaatc
ggtttactaccaaatacagaatttttacaaggtgcaattacaatgaacgcacatggtgaa
attattgtagataagcacggcgcaacaaatatgccaggtgtctttgcagcaggtgactgt
acagatgcagcttataaacaaattattatttcaatgggctctggtgctacagcagcactt
ggcgcattcgattatatgattcgccatacatcaggtgaatccgaattaatgggcgtataa

DBGET integrated database retrieval system