KEGG   Solenopsis invicta (red fire ant): 105193841Help
Entry
105193841         CDS       T03916                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00052  Galactose metabolism
soc00500  Starch and sucrose metabolism
soc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105193841
   00500 Starch and sucrose metabolism
    105193841
Enzymes [BR:soc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105193841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 105193841
NCBI-ProteinID: XP_011156768
LinkDB All DBs
Position
Unknown
AA seq 583 aa AA seqDB search
MFRSCILIAALIALTGSNSVQVDGKDWYKNSLVYQIYPRSFKDSDKNGIGDLRGITSKLD
HVKDIGADALWMSPIFSSPQADFGYDVSNYTDIDDDYGTLDDFDALVAKAKKLGLKVILD
FVPNHTSDEHQWFKNSVKGLKPYDEYYVWRDPKEVKKDGTPVPPNNWMSVFGGSAWNYSE
VRKQFYLHQFDPKQPDLNYHSNALQEEMKNVLTFWMNRGVEGFRIDAINHMYEDSRFLDE
PSSNRSDLPEDDYDILDHIYTKNLPETYDVLQSWRRLMDENPTTANTKMILTEAYADFDL
TIKYYKSGSTVPFNFMFIADLNNKSKANDFKNSIDRWMKNIPDGPEYVANWVVGNHDNHR
AASRFGEQRADQLSMLAIVLPGVSVIYNGDEIGMLDTKFTWEETKDPAGCRAGPDRFEEK
SRDPERTPYQWDSSPNAGFSEAEKDKLWLKVNENYESLNLAKQKDDLISHYKIFKLLSRL
KKKPVIEQGSLKTAVYCAECFPVDNVLGVVRRHGKSVVVLMVNFEDDKPVTVNAKLWLNI
REQLIIYAPSLNSKLLPGTSVDMTSVTLPAAASVVFVTSDLFE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgctcgtgcatcctcattgcggcgttgatcgctctgaccggctcaaactcggtc
caggtagatggtaaagattggtataagaacagtctggtgtatcagatctatccaagaagc
ttcaaggacagcgataagaatggcattggcgatttgcgaggtatcacgagcaagttggat
cacgtaaaggacattggcgccgatgcgctatggatgtcaccgatctttagcagcccgcag
gctgatttcggatacgacgtttctaattataccgatattgatgacgactacggtacctta
gatgactttgacgctctcgtggcgaaagcaaagaaacttggactgaaagtaatccttgat
ttcgtgccgaatcatacctctgacgagcatcaatggttcaaaaacagcgtcaaagggcta
aagccctacgacgaatactatgtctggcgtgatccgaaagaagtaaaaaaagacggcaca
ccggtaccaccaaacaactggatgagcgtttttggaggttccgcttggaactatagcgag
gtgcgaaaacagttttatctgcatcagttcgatcctaaacaaccagacctcaactatcat
agcaatgcgctacaagaagaaatgaaaaatgtgttgactttctggatgaaccggggcgtg
gagggctttcgtattgacgctatcaaccatatgtacgaagattcccgatttttggacgag
ccgtcaagtaacagatctgatttaccagaggatgactacgatatcctggaccacatttat
acgaaaaatcttcctgagacttacgacgttctccagagctggagacgtttgatggatgaa
aatccgacgaccgctaatactaagatgatcctgaccgaagcctatgcggacttcgatctt
actataaagtactataagtcgggctcaacggtgccgttcaacttcatgtttatagcagat
ctaaacaataagtccaaagcaaacgatttcaagaactctattgatcgctggatgaagaat
atacctgacggtccagaatatgttgcgaattgggtagtgggcaatcacgacaatcatcgc
gcggcttccagattcggcgaacaacgagccgatcaactttccatgctggcgattgtttta
cctggtgtgagtgtgatttacaacggtgatgagatcggtatgcttgatacaaagttcaca
tgggaagaaaccaaagatcctgctggatgcagagctggaccagatagatttgaggagaaa
tcgcgagatccggaaagaacgccttatcaatgggacagcagccctaatgccggcttctct
gaagccgagaaggacaagctttggcttaaagtgaacgagaattacgagagtctaaatttg
gcaaagcaaaaagatgatttaatctctcattataaaatattcaagcttttgagtagacta
aagaagaagcctgtcatagaacagggctccttgaagactgcggtgtattgtgctgaatgt
tttcccgtcgataatgttctaggggtggtacggcgacacggaaaatctgtcgtagtgctc
atggtgaatttcgaagatgacaagccggtcacagtcaacgctaagctctggctgaatatt
cgagagcaattgattatctatgcacctagcctaaactccaaactgcttccaggaacgagc
gtcgatatgacttctgtcactctgcccgctgcggcttctgttgtgttcgttacatcagat
ttgtttgaataa

DBGET integrated database retrieval system