KEGG   Solenopsis invicta (red fire ant): 105195992Help
Entry
105195992         CDS       T03916                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00020  Citrate cycle (TCA cycle)
soc00190  Oxidative phosphorylation
soc01100  Metabolic pathways
soc01200  Carbon metabolism
Module
soc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
soc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
soc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105195992
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105195992
Enzymes [BR:soc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105195992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA DAO HI0933_like FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 105195992
NCBI-ProteinID: XP_011159988
LinkDB All DBs
Position
Unknown
AA seq 663 aa AA seqDB search
MSGLLKLSASLLPRSMPGAVTLNKLGLPLLLGNRKLHHTTDRAAKISDEISKQYPLVDHT
YDAVVVGAGGAGLRAAYGLVAEGFKTAVVTKLFPTRSHTVAAQGGINAALGNMEEDNWQW
HMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTTDGKIYQRAFGGQSLKFG
KGGQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLLMQDGECRGVIALCLED
GTLHRFHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRANLPNEDLEFVQFHPTGIY
GAGCLITEGSRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRSMTMEIREGRGVGPEK
DHIYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVIPTVHYNMGGVPTNYKGQA
LMRENNQDKVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACAKTITQENKPGEAI
GPLKPNAGEETVANLDWVRNANGSISTAELRLTMQKTMQKHAAVFRDAESLKEGCQKMTD
LYKKLDELKVADKSLIWNSDLIETLELQNLMINAMQTIIGAENRKESRGAHAREDCKQRI
DEYDYSKPIENQQPKPLDQHWRKHTLSKINPRTGEVSLDYRPVIDVTLNQEECATVPPAI
RSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggctgctgaagctgtcggcgtcgttgctgccgaggagcatgcccggagcggtg
acgctgaacaagctgggactgccgctcctcctcggcaaccgcaagcttcatcacacgaca
gaccgagcggccaagatctccgacgagatctccaagcaatatccgttggtggaccacacg
tatgacgcggtggtggtgggagccggtggcgccggtctacgcgcggcctacggcctcgtg
gccgagggcttcaagaccgcggtggttaccaagctgttcccgacgaggtcgcatacagtc
gccgctcagggcggcatcaacgccgccctgggcaacatggaggaggataactggcagtgg
cacatgtacgacaccgtcaaaggctcggactggctgggtgaccaggatgccattcactac
atgactcgcgaggcaccaaaggccgtcatcgagctggagaactgcggcatgcccttcagc
cgtactacggacggcaagatctatcaacgtgcattcggcggtcaatctctcaagtttggc
aagggtggccaggctcatcgatgctgttgcgtggccgacaggaccggtcactcgttgctg
catacactttacggccagtcgctgagctacgactgtaactacttcgtcgagtacttcgct
ctcgatttgctgatgcaggacggcgaatgccgcggggtgatcgcgctctgtctggaagac
ggaacgttgcatcgcttccacgccaagaatacggtgcttgccaccggcggctacgggcgt
gcctacttttcctgcacatccgcgcacacctgcaccggggatggcactgctatggtctcc
agggccaatctgcccaatgaagacctggagtttgtgcaattccatcctacaggtatctac
ggtgccggttgcttgatcacggaaggaagccgcggcgaaggtggttatttaataaacagc
gaaggtgaaaggtttatggaacgttacgcgccggtagcaaaggacctggcatcacgagat
gtggtgtctagatcaatgacaatggaaattagagagggcagaggcgtcggaccggagaag
gatcatatttacttgcagttgcatcacctgccgcctgaacaacttgccgctcgattgcca
ggaatttcggaaactgcgatgatattcgctggtgtcgacgtgacccgggaacccatcccc
gttatacctactgtccattacaatatgggaggtgtgccgacgaattacaaaggtcaagcg
ttgatgagggaaaacaatcaggacaaagtagtgcccggcttatatgcatgtggcgaggca
gcttgtgcgtccgttcacggtgctaatcgacttggtgccaactctctattggatttggtc
gtattcggacgtgcatgcgctaaaactattacccaagagaacaagcctggcgaggcaatc
ggacccttgaaacctaacgctggtgaggagacggtagctaatttagactgggtcagaaac
gccaacggttccatttctactgcggaattaaggctgactatgcaaaaaactatgcagaag
cacgcggcagtcttcagagacgccgaaagtttgaaagaaggctgtcagaagatgaccgac
ctctacaaaaaattagacgaactgaaggttgcggacaagtctttaatatggaactccgat
ttgatagaaacgcttgaattgcaaaatctgatgattaatgcgatgcagaccatcattggg
gcagagaataggaaggaaagtcgtggcgcacatgctcgcgaagattgcaaacagagaatc
gatgaatacgattacagtaaaccgatcgaaaatcagcaaccgaaaccgctcgatcaacat
tggagaaaacatacattgtcaaagatcaatccgagaacaggagaagtgtctctcgactat
agaccggtaattgacgttacgctcaatcaagaggaatgcgcgacggttccgccagcgatt
cgatcctactag

DBGET integrated database retrieval system