KEGG   Solenopsis invicta (red fire ant): 105196322Help
Entry
105196322         CDS       T03916                                 

Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00052  Galactose metabolism
soc00500  Starch and sucrose metabolism
soc01100  Metabolic pathways
soc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105196322
   00500 Starch and sucrose metabolism
    105196322
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105196322
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:soc04147]
    105196322
Enzymes [BR:soc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105196322
Exosome [BR:soc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105196322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 105196322
NCBI-ProteinID: XP_011160510
LinkDB All DBs
Position
Unknown
AA seq 1036 aa AA seqDB search
MVALKANGQDIPEKSEYHGAIQDQSNNPAGGFNTIMIKTLCNEAYKPSTKKHEKEWNLDK
NIRRIIILLFFSLITFSFLFYFGTPLLSMIINPLYTTESNYNAEMEFMIDINNDSIEETR
YQHILVDTPDIYIEEETYDREIVPWNKESDLPEESTAFNNAQQCSNIPEILRFDCHPETG
ASQLSCTNRGCCWNPIGENKNEKHVPLYIPYCYYPDGWDLYKYVNYSQDDSSFLGFLSKK
KESIYKNNVPLVKVEATSVNASILRVKIYDPLKPRYEPPWPIRSDPKPFSYQVADTKYRF
YSDGVKPGFKVVRTSDATSLFNSIGIGGFIFADQFLQISTLLPSNNIYGIGEHRSSLKLN
TNWQLFTLFNKDQPPTENANLYGSHPFYIVVEDSGMAHGVLFLNSNAMDVILQPTPAVTF
RTIGGIFDIYFFLGPTPADVVRQYSEIVGKPFMPPYWSLGFHLCRFGYGSLENTKAVWNR
TRAAGIPFDTQWNDLDYMDKNNDFTYNKEKFKDLPEFVKEIHAAGMHYIPLIDAGISASE
DNGSYLPYDEGIKQDIFVKDGISHKPFVGKVWNYVSTVWPDFTNPKTVMYWANMMANMYD
SFTYDGAWIDMNEPSNFYNGHKNGCMHNNLDYPNYVPNVVGDLLATKTICMNAKHYLGTH
YDLHNTYGTSEAIATNYALKKIRQKRPFIISRSTWVGHGHYAGHWTGDDYSSWHDLKMSI
PAILSFNFYQIPMVGADICGFDGNTTAALCNRWMQLGAFYPFSRNHNSDDTIDQDPVAMG
DLVVQSSKNSLRIRYRFLPYLYTLFFYAHKFGVTVARPLFFEFPNDRQTYDIDTQFLWGS
ALMIIPVLEENKIEVAAYVPRGVWYNYYTFNSFFAIGKHYTLSAPIDRIPLLVRGGSILP
TQKAGVTTTESRKNDFELIVALDETGNAKGQLYWDDGDSLDSIKEKKYLWLSFIANQTNL
FNKEEDKGFFNEEVILGKVQIWGLQQQVSRVFLNGNEIGFKYNAFTFSLDIIGLQVDMRQ
PFVFYWMMEDPNENIN
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggttgctttaaaggcgaatggacaggatattcctgaaaaatcagaataccatggtgca
atccaagatcaatcaaataatcctgcaggaggatttaatactatcatgattaaaacatta
tgcaatgaagcctacaagccatcaacgaaaaaacatgaaaaagagtggaatcttgataag
aatataagacgaataataatattattattcttcagcctcatcacattttctttcttgttt
tattttggtacaccactattatccatgattataaatccattatataccactgagagtaat
tacaatgccgaaatggaatttatgattgacataaataatgacagtattgaagaaacaagg
tatcagcatatattagtggatactccagatatatacattgaagaagaaacgtatgatcgc
gaaatagtgccttggaacaaagaaagtgacttacctgaagaaagcacagcttttaataat
gctcaacagtgtagcaacattcctgaaatattgcgctttgattgtcatcctgagactgga
gcatcacaactttcttgtacaaacagaggatgttgttggaatcccattggggagaacaaa
aatgaaaagcacgtgccattgtatattccttattgttactatcctgatggatgggatctg
tataaatatgttaactatagtcaggatgatagcagttttttgggctttctcagcaaaaag
aaggaatctatatacaaaaataatgtgcctcttgtgaaggtagaagccacaagcgtaaac
gcctcaattctgcgtgtgaagatatatgatcccttgaaaccgcgatatgaaccaccatgg
ccaattagatcggatccaaagccattttcgtaccaagttgctgatacaaagtatcgattt
tatagtgatggtgtaaagcctggctttaaggtcgttagaaccagtgatgccacatcactg
tttaattctattggaattggaggtttcatatttgccgaccagtttttacaaataagcaca
ttgctaccatcgaacaatatttatggtattggcgagcatagatcgagcttaaaattaaat
actaattggcagttgttcactttatttaataaagaccaaccgccaacggaaaatgcgaat
ttgtatggttctcatccattttatattgttgtggaagattctggaatggctcatggggtt
ttatttttaaacagtaatgccatggatgtgatattgcagcctacaccggctgtaacattt
agaacgattggtggtatcttcgatatttattttttcctggggcctactccagccgatgta
gtgagacaatactcggaaattgtaggtaaaccatttatgccaccttattggtcactcggt
tttcacttatgcaggtttggatatggatcgttggaaaatactaaagcagtatggaacaga
actagagcagctggaattccatttgatactcaatggaacgatctggattatatggacaaa
aataatgattttacgtataataaagagaaattcaaagacttgcctgaatttgtgaaggaa
attcacgcggcagggatgcattatattccattaatagatgctggcatatctgcttctgaa
gataatggttcttatctgccttacgacgagggaataaaacaagatatattcgtaaaggac
ggtatatcccataaacctttcgttggcaaagtctggaattatgtttccacggtatggcct
gattttacgaatcctaaaactgttatgtactgggcaaatatgatggccaatatgtacgac
agtttcacgtacgacggtgcatggatcgatatgaatgaaccgtccaatttctacaatggt
cataaaaacggctgtatgcataataatttagattatccgaattatgttccaaacgtcgtt
ggtgatttgctcgctacaaagactatttgcatgaatgcaaaacactatttgggcactcac
tatgatcttcacaatacttatggaacgagcgaagcgatcgcgacgaattatgctcttaag
aaaattagacaaaagagaccatttataatatcgcgttcgacatgggtgggacacggtcat
tatgcgggtcattggacaggtgacgattattcatcatggcatgatttgaagatgagtatc
ccagctattttgtcattcaatttttatcaaattcctatggtgggtgcagatatttgtggt
ttcgatggaaacacaaccgctgcattgtgtaatcgctggatgcaactcggtgccttttat
ccattttctcgaaatcataattccgatgatacaattgatcaagatccagttgctatgggt
gacttagttgtacaatcgtcaaaaaattctctcagaatacgttatcgatttttaccgtat
ttgtacactttgttcttctatgctcataaatttggagtaacagtggcacgaccattattc
tttgaatttcccaatgaccggcagacttacgatattgacacacaatttctttggggaagt
gcgcttatgatcattccagttctcgaagaaaacaaaattgaggtagctgcatacgtaccg
cgtggtgtctggtacaattattatacctttaattctttcttcgccatcggaaaacattat
accttatcagcgccgattgacagaataccattattggttcgtggaggctcaatacttcca
acacagaaagcgggtgtaacgacgactgagagcagaaagaacgattttgaattaatagta
gcgttagatgaaactgggaatgctaaaggacaactgtattgggatgatggtgatagttta
gattctataaaagagaaaaaatatttatggctgtcttttattgcgaaccaaactaattta
ttcaataaggaagaggataaaggcttttttaatgaagaggtaattcttggaaaagtacag
atatggggattacaacaacaagtctccagagtatttttaaatggaaatgaaataggattt
aaatataatgctttcacattcagtcttgatatcattggcttgcaagtggatatgagacaa
ccattcgtattttattggatgatggaagatccaaatgagaatattaattaa

DBGET integrated database retrieval system