KEGG   Solenopsis invicta (red fire ant): 105196647
Entry
105196647         CDS       T03916                                 

Definition
(RefSeq) fibroblast growth factor 14 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
soc  Solenopsis invicta (red fire ant)
Brite
KEGG Orthology (KO) [BR:soc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:soc04052]
    105196647
   00536 Glycosaminoglycan binding proteins [BR:soc00536]
    105196647
Cytokines and growth factors [BR:soc04052]
 Growth factors
  Growth factors (RTK binding)
   105196647
Glycosaminoglycan binding proteins [BR:soc00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   105196647
SSDB
Motif
Pfam: FGF RecO_N
Other DBs
NCBI-GeneID: 105196647
NCBI-ProteinID: XP_011160982
LinkDB
Position
Unknown
AA seq 319 aa
MRCRTVAHDSYFLLVTTNRECHGECCFRVSEINRNKLPQRFLALDARCENGFVNLCSSSA
RAARRNQVKMSLRWIHENLEAPTCDEECSDIDDSCSDDSYDTELSLSEKEERDEDVTTEN
GKVQGIARGGLRKKRETRRPAAAAARPTSTVTFHGNGGTPRNIERKSKSREYSPYVIWDP
RQPAKNPIYNCRIIKLYCRTGYHLAITPSGRVEGLSENEDSHALLHATPVSFGVIRIQSI
ETRLYLAFNEKGRLYGEINMTKDNTEWEQWSIGSYDAFRSRKYVRYGWWIGVKKNGRAKP
GPKTFWGQKAIQFSAIQQD
NT seq 960 nt   +upstreamnt  +downstreamnt
atgcgctgtcgcactgtcgcacacgattcttattttctacttgtgactactaatagagag
tgccacggagaatgctgttttcgcgttagcgaaataaatcgaaataaattaccacagaga
tttttagcgctagatgcgcgatgtgaaaatggattcgtgaatttatgcagcagcagcgcc
cgcgccgcgcggagaaaccaagtgaaaatgagtttgcgctggattcacgaaaatctagaa
gcgccaacgtgcgacgaagagtgcagcgatatcgacgacagttgcagcgacgacagctat
gacacggaattgtccctttcggagaaggaggagagggacgaggacgtgacgacggaaaac
ggaaaagtgcagggtatcgctcgcggtggcctgcggaaaaagagggaaaccagaagacca
gcagcagcagccgcccgcccgacctcgaccgtcaccttccacggaaacggcggaacgcca
cgcaacattgaacgtaaatccaaatcacgcgagtattcaccttacgtaatatgggatcct
cgacagccggcgaaaaatcctatctacaattgccgaataattaagctgtactgccgtacc
gggtatcatctggcaattacgccgtcaggacgggtcgaaggattatccgaaaacgaggac
tcacacgctctgcttcacgcgacaccggtatctttcggcgttatcagaatacaaagtatc
gaaacgagactctacttggcattcaacgagaagggacgcttgtacggagagataaatatg
actaaagacaataccgaatgggaacaatggagcattggttcctacgatgcgttccgatcg
cgtaaatacgtgcgatatggctggtggataggagtaaagaaaaatggacgcgcaaaaccc
gggccgaaaacattttggggacaaaaagcgatacaattttcggctatccaacaggattga

DBGET integrated database retrieval system