KEGG   Solenopsis invicta (red fire ant): 105198699
Entry
105198699         CDS       T03916                                 

Definition
(RefSeq) uncharacterized protein LOC105198699
  KO
K16679  wengen
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc04013  MAPK signaling pathway - fly
soc04214  Apoptosis - fly
soc04215  Apoptosis - multiple species
soc04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:soc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105198699
   04391 Hippo signaling pathway - fly
    105198699
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105198699
   04215 Apoptosis - multiple species
    105198699
SSDB
Motif
Pfam: TNFR_c6 TFIIA Trp_oprn_chp PRIMA1 Mito_fiss_reg
Other DBs
NCBI-GeneID: 105198699
NCBI-ProteinID: XP_025990227
LinkDB
Position
Unknown
AA seq 356 aa
MPRESCPGLLLTLVSVFVSLCESSGAHAHAHAHAHAHAHAHAHAHHVQQPRPQPQQQQQP
QPQPQPQSQQQHSTVCKLGLEFWSVERASCWPCTRCAPEFTLSPCAIHKDAVCGPLSALE
LDWSFLSAAAAAAAAGCGSLRTRERPSLVEAGNLVNFDRDGDKEPIFVSRESKTHDPRER
RKSADEDNLSWDWQTGALILAVCACIVFFLVAGCSALVYARQWRRMKRNFEPAGLEEISA
RLNLMVKAELAELVAGAPMNPGDPETRCQYLEKLLDRKRETPVVTTTTTTTTTTMAAAGN
LYIEEGRTTTSTSTTPTPSPPPPPPPPPPRSKRSQIARIQRNIETILNYKMSQGAD
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgccgagggaatcttgtcccgggttactgttgaccctggtgtcggtattcgtcagcctg
tgcgagtcctccggcgcccacgcccacgcccacgcccacgcccacgcccacgcccacgcc
cacgcccacgctcaccacgtccagcaaccacggccgcagccacagcagcaacagcaaccg
cagccacaaccgcagccgcagtcgcagcagcaacattcaaccgtttgcaagctcggcctc
gagttctggtccgtcgaacgcgcctcgtgctggccgtgcacccgatgcgcccccgaattc
accttgagcccgtgcgcgattcacaaggacgcggtatgcggtccgctatcggcgctcgag
ctcgactggtccttcctgtcggcggcggcggcggcagcggcggcgggctgcggcagcctc
aggacgagagaacggccgtccctcgtggaagccggtaatctcgtcaactttgatcgcgac
ggcgacaaggagcccatcttcgtctcacgggaatctaaaacgcatgatccgcgagaaagg
agaaaatcggctgacgaggataatctatcgtgggactggcagaccggtgcactgattctc
gcggtatgcgcctgcatagtattcttcttggtagcgggatgctcggctctcgtctacgcg
cgacagtggcgacgaatgaagaggaactttgaaccggcgggtctcgaggagatttcggct
aggttgaacctaatggtgaaggcggaactggccgaattggtcgcaggggcaccaatgaat
ccaggtgatcccgagaccagatgtcagtatcttgagaagcttttagaccggaaacgagag
actccggtggtgacgacgacgacgacgacgacgacgacgacgatggcagcggctggcaac
ttgtacatcgaagaaggaagaacgacgacgtcgacgtcgacgacgccgacgccgtcgccg
ccgccaccgccgccgccgccgccgccgagaagcaagcgatcgcagatcgcgcggattcaa
cgtaacatcgaaaccattctcaattacaagatgagtcagggcgccgattga

DBGET integrated database retrieval system