KEGG   Solenopsis invicta (red fire ant): 105201589
Entry
105201589         CDS       T03916                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00230  Purine metabolism
soc01100  Metabolic pathways
soc04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105201589
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105201589
Enzymes [BR:soc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105201589
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258 Prefoldin_2
Other DBs
NCBI-GeneID: 105201589
NCBI-ProteinID: XP_011167952
LinkDB
Position
Unknown
AA seq 952 aa
MSQQQQTPTNEDSYLSSGRPSNLLKTSFSSARLEKLYRASSLQQRRGGLTCFLMSAILFG
LYMVTIPGMELPARCVSAVFILLNGVLLLWVESGTKTRNSLWSLVPCIVGQLWIVYLPAQ
LFLKSTKVTLRDSLGWMLLLLYLLFATLPLKLCRCMFLAFGSVLVYFSAVIGLSSATLED
LKTLPVDVLILTLTLFAGACILGACCYCLAEFQQRRAFLETRQSLEVQLMIEEQSAEQER
LLLSVLPEHVAVKMRQDLGASLDTQFKKIYMSRHENVSILYADIVGFTAISSTYSAGELV
KILNELFARFDQLSERYEQMRIKILGDCYYCISGAPIERPDHAVLCVYMGLSMVEAIKYV
QQTTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGRAGRVHISNATL
SFLNGEFEVEPAHGEDREEALQKAGLVTYFIVKALKPFKPAVTKSLASLNADAENSQRII
ENMQDKMDHIREDSEEFQQRLRKKLDSRGGGTDLKGHASWLTLRFKDPNVETAFHSVEEA
FSPLSLLGGPLVTMCAAPAWRLQPWGPFTWGGAGVVALFGVVLAGATCLGSAVRATWLRS
TLALLMTFSLIIFLLLDMTNCVIIDDIEPPKNTSINWSSRCPYPSYYSYIGVLALIAISM
PTYLCYPTKACLMYFLAGAQSCINALFLGSSLDREDKASNQESVPFPLKYSLTTTLFTIA
NALIIVSRYAEKARRMLYLRGREVIAQRERAADMKRRNGALIYNILPSHVATYFLSHARH
YDDLYSQSYAEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAILDQKKFKS
IIKIKTIGSTYMAASGITEVQSVQSEDGPQWGHLVTLVEFALELKKALSSINEQSFNHFV
LKMGINHGPVTAGVIGARKPHYDIWGNTVNVASRMESTGKVGCIQVSIKKMH
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgtcgcagcaacagcagaccccgacaaacgaggattcctacctgagcagtggcaggccg
tcgaacttgctgaagacgagcttcagcagcgcccgtctcgagaagctctatcgcgcctca
tcgctgcagcagcgtcgcggcggcctcacgtgcttcctgatgtcggcaatcctgtttggc
ctctacatggtgacgataccgggtatggagctgccggcacgttgcgtcagcgccgtattc
atcctcctgaacggcgtcttgctgctctgggtcgagagcggcaccaaaacgcgtaactcg
ctctggtcattggtgccgtgcatagtcggacagctgtggatcgtgtacctgcccgctcag
ctgttcctcaagtccaccaaggtcacgctgagggacagcctaggctggatgctgctactg
ctctatctgctgttcgccaccctaccgctcaagctgtgccgttgcatgtttctcgcgttc
ggcagcgtgctcgtgtacttcagcgccgtgattggtctctccagcgcgacgctggaggat
cttaaaacactgcctgtcgacgttctgatcctgacgctgacgctcttcgctggcgcctgt
atcttgggtgcctgctgctactgcctggcggagttccagcagcgccgcgcatttctggag
accagacagagcttggaagttcagctgatgatcgaggagcagagcgcggagcaggagcgg
ctattgctcagcgttctgccggagcacgtggcggttaagatgcggcaggacctcggtgcg
tccctcgacacgcagttcaagaagatctacatgtccaggcacgagaacgtgtcgatactt
tacgccgacatagtcggcttcaccgcgatctcgtcaacctatagtgccggcgagctggtc
aagatactcaacgagctcttcgcgcgattcgatcagctcagtgaacgatacgagcaaatg
cgcatcaagatcttgggggactgctattactgcataagtggtgcacccatcgaaaggcca
gaccacgcggtcctctgcgtgtacatgggactgtccatggtggaggcgattaaatacgtt
caacaaacgacgaacagccccgtcgacatgagggtgggcattcacacgggtgcggtactc
gccggggtcctcggacagaggcagtggcagtttgacgtttatagcaaggacgtcgagctg
gcgaacaagatggagagcagcggaagagcggggagggtacacatctcgaatgcaacgttg
agcttcctaaatggagaattcgaggtcgagccggcgcacggggaggatcgggaagaggca
ctccagaaagctggcctcgtcacttactttatcgtgaaagccttgaaaccatttaagcca
gcggtgacaaaaagcctcgcatcgctgaacgcggacgcggaaaactcgcagagaataata
gagaatatgcaagacaagatggatcatattcgagaggattccgaggaatttcagcagcgc
ctcaggaagaagctggacagtagaggtggtggtaccgacctgaaaggtcacgcctcctgg
ttgaccctacggttcaaggatccaaacgtggagacagcgttccacagcgtcgaggaggcc
ttctcgcccctgtcgcttctcggcggacctctggtcacgatgtgcgcggccccggcctgg
aggctgcaaccttggggaccgttcacgtggggtggcgccggggtagtcgccctcttcggc
gtcgtgttggccggagctacctgcctgggcagtgcggtcagggcgacatggctcagaagc
accctcgcactcctgatgacgttctccctcataatcttcctgctgttagatatgaccaac
tgcgtgatcattgacgacatcgagccaccgaagaacacctcgataaactggtcctcgcga
tgcccgtatccttcttattattcgtacatcggcgtcctcgcgctaattgctatctcgatg
ccgacgtacctctgttacccgaccaaggcgtgcctgatgtacttccttgccggtgcgcag
tcatgcatcaatgccctattcctcggatcgagcctcgacagggaggataaggcatcgaac
caggaatccgtgccctttccactgaaatattcgctgacgaccactttgttcaccattgcg
aatgcgctaatcatcgtgtcgagatacgcagagaaggcgcgaagaatgttgtatctgcga
ggacgagaggttatcgcgcaaagagaacgagcggcggacatgaagcgaagaaatggtgcg
ctgatatacaatatcctaccgtctcacgtggccacttatttcctatcacacgcgaggcac
tacgacgatctctacagccaaagctatgccgaggtgggcgtactgttcgctagtatgccg
aacttcgcggacttctacagcgaggagagcatcaacaatcaaggcctcgagtgcctcagg
ttcctgaacgaagttatctccgactttgacgccatcctcgatcagaaaaaattcaagagc
atcatcaagatcaagacgataggatcgacctatatggccgcttcgggcataaccgaggtg
cagtcggtgcagtcggaggatggcccgcagtggggccacctcgtcactctcgtggagttt
gccctggagcttaagaaggccctgtcgagcatcaacgagcagagctttaatcacttcgtt
ctgaaaatgggcatcaatcatggaccggtgactgccggtgtcatcggcgcgcggaagcct
cactatgacatttggggcaacaccgtcaatgtcgcgtcgaggatggagagcacggggaaa
gtcggttgcattcaggtatcgatcaaaaagatgcattag

DBGET integrated database retrieval system