KEGG   Solenopsis invicta (red fire ant): 105202226Help
Entry
105202226         CDS       T03916                                 

Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
soc  Solenopsis invicta (red fire ant)
Brite
Enzymes [BR:soc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105202226
Protein phosphatases and associated proteins [BR:soc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105202226
Messenger RNA biogenesis [BR:soc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     105202226
Membrane trafficking [BR:soc04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    105202226
Chromosome and associated proteins [BR:soc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     105202226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP C1_2
Motif
Other DBs
NCBI-GeneID: 105202226
NCBI-ProteinID: XP_011168935
LinkDB All DBs
Position
Un
AA seq 1173 aa AA seqDB search
MTESTVNLDLFTAAKQLADSEIELLKVIENSSKCQRTATNMLTANTKKMKKPGKSKNAHP
SAALLAAKQEAVRRQLSDKKSNNNFVPDIYQRVIDTYKTMRKETGLVFDRSMAEHECIWD
PNYPECPARFTRVLRRCEELGLVQRCRLIEPRLAAESELLSKHSQKQIDILKATDGSTDF
ENLELLSSKYDCVYIHPSTYRLSLLAVGSTTNLVESVCKGEIQNGMAIIRPPGHHAMKSE
YCGYCFFNNVALAAEKALSSGLANRILIVDWDVHHGQATQQMFYNDPRVVYFSIHRYEHG
EFWPNLRESDFHYVGEDLGEGYNFNIPLNKTGMTNADYIAIFQQVLLPMAYEFQPDLIIV
SAGYDAALGCPEGEMLITPACYSHLLSSLLSLANGKVAVILEGGYCLKSLAEGAALTLRT
LLGDPCPILQTLDLPSLSIRETILNVIYAHKPYWKCYQYQDTYSINNITHNKEEIANRHV
VMVTYKGNEVKLDKYDTRNCYPVQSKETLETVEKKLNELIQLTNLRKAPHRVCIVYDEKM
QKHCNVSDNSHPEKPSRISSIYKNHEEHGVLQRCHLLQGRSATIEELALVHSKDYIDDIK
QTSTLKLKELDKQASDYNSVYLHTETWSSACMSTGSLLQVVDAVLNGECQSGVAIVRPPG
HHAEKDNACGFCIFNNVAVAAMYAVQFHLVKRVLIIDWDVHHGNGTQSIFEEDPRILYVS
VHRYDNGSFFPNSKIANYTNVGLNAGEGFNVNIPWNKKGMGDAEYIAAFQQVVMPIAYQF
NPELVLVSAGFDACIGDTLGGCLVSPELYGHLTHWLSSLANGRIILSLEGGYNINSISHA
MTMCTKTLLGDPLPMLDPSLIPCTSAINSINNVLRTHKKFWSNLQYGMSLPKEKVLPKLK
TVPNKHEEQGRNADKPKQMEPKIALEGIESEKLELNLAIDKNCLNLVTDEEISKLTCEVE
NIKIKNFELHTMKSEAIEAKRNPELKQNEAKNLDVSQSIHKCVNETNQSRDNQQGDSNIR
EDRDDQAASSSQRGTQATTLSEYLSENLRALNAGEMFAVYPLQDCPHLVTLNDVPPGGIN
VNVPCVECDRTEENWICLQCYTVHCARNINRHAMEHAEEHEHPLTLSFSDISVWCYGCEA
YIDNPRLYAARNAVYQSKFNEELPWTYSESRTE
NT seq 3522 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatctacagtgaatctagatttgtttactgctgctaaacaactagcagacagc
gaaattgagctgttaaaagtgattgagaactccagcaagtgccaaagaactgctacaaac
atgttaactgcgaatactaagaaaatgaagaaacctggaaaatcgaaaaatgctcatcca
tcggctgcgctattagccgctaagcaagaggcagtcaggcgacagttatcagacaagaaa
tccaacaataattttgtaccagacatatatcaacgagtgattgatacgtacaaaacgatg
cggaaagagactggtctcgttttcgatcggagcatggccgagcatgagtgcatctgggat
ccaaattatcctgagtgcccagccagatttacgcgagttttgcgaagatgtgaggagctg
ggtctcgtgcagcgatgtagactcattgaaccaagactcgccgcggagagcgagcttttg
agcaagcacagtcagaaacagattgatatcttgaaggcaacggacggttctacagatttt
gaaaatttggagttgctctcgtctaagtacgactgtgtctacatccacccgtctacttat
agattgtctttattagctgtgggctcaacgaccaatttagtagaaagcgtctgtaaaggc
gagatacaaaatggcatggctattatcagaccacctggtcatcatgcaatgaaatcggaa
tattgcggttactgctttttcaacaatgtagctttggcagcagagaaagctttaagttca
ggtttggcgaatagaattttaattgtagattgggatgttcatcatggacaagcaacgcaa
caaatgttttacaatgatccgcgtgtagtttacttttcgatacatcgttacgagcatggc
gaattctggcctaacttgagggaatctgattttcattatgttggagaggacctcggcgag
ggttacaactttaacattcctttaaataaaaccggcatgactaatgccgattacatcgcg
attttccagcaagttttattaccaatggcttacgaatttcaaccggatttgataatagta
tcagcaggttacgatgcggctctgggttgtccagagggtgaaatgctgataactccagca
tgttattcacatttactgtcatcgttattaagtctggcaaatggaaaagtcgccgtgatt
ttagagggtggttattgcctgaaatcattagcagaaggtgcggcattgactttaagaact
ttattaggcgatccatgtccgattttacaaacacttgatttaccatcgttaagtatacgt
gagactatcttgaatgtaatctacgcgcataaaccatactggaagtgttatcagtaccaa
gacacatacagcatcaataatataacacataacaaagaggaaattgccaatcgacatgta
gtcatggttacatacaagggtaatgaagttaaactggacaagtatgacactcgaaattgc
tatcctgtacaaagcaaagaaacgttagagactgtggagaaaaaattgaatgaactgata
caattaacgaacttgcgtaaagcaccccatagagtatgtatcgtctatgatgaaaaaatg
caaaaacattgcaacgtttctgacaattctcatccagaaaaaccaagtcgcatctccagc
atttataagaatcacgaagaacatggcgtattacaacgatgccatttattacaaggaagg
agtgcaacaatagaagagttagctttggtccattcaaaagactacatcgacgacattaaa
cagacatcaactttaaaactcaaggaattagacaagcaagcttcggattacaattccgtt
tatcttcacaccgaaacgtggtcgagtgcctgcatgtccaccggctctctgctgcaagta
gtggacgcagttttaaatggagagtgccaatccggagttgctatcgtgaggccgcctgga
catcatgctgaaaaagacaatgcgtgtggtttttgtatatttaacaacgttgccgtggct
gcaatgtatgctgtacaatttcatcttgtaaagagggtattaataatagattgggatgtg
catcatggaaatgggacgcagtctattttcgaggaagatccaagaattctttacgtctcc
gttcatcgttacgacaacggaagcttctttccaaattccaagatcgctaattatacgaac
gttggcttaaacgcaggcgagggattcaatgtgaacataccgtggaacaagaaaggaatg
ggagatgctgaatatatagcggccttccagcaagttgtgatgcctatcgcttaccaattt
aatccagagttggttctggtttcggccggatttgatgcttgtattggcgatacacttgga
ggttgtcttgtaagcccagaactctacggtcatttaactcattggctttcgtccttggcc
aatggtcgtataatcttgagtctcgaaggaggttacaacatcaactccatctcgcacgcg
atgaccatgtgcaccaagaccttgctgggtgatccgttgccgatgctagatcccagtctt
attccttgcaccagcgcgatcaattccatcaataacgtattgaggactcataaaaagttc
tggtccaacctgcagtatggaatgtccttaccgaaagagaaggtacttcctaaactcaag
acggttcctaacaaacacgaggagcaaggaagaaacgcggataaaccaaaacaaatggaa
ccaaagattgctttggagggaattgaaagtgaaaaactcgagctgaacttggctattgac
aagaactgcttgaatctagtgacggacgaggaaatctcgaagctaacgtgcgaagtggaa
aatattaagataaaaaatttcgaattgcacacgatgaaaagtgaagcgatcgaggcgaaa
aggaatcctgaattgaagcagaacgaggcgaaaaatctggatgtttcacaaagtatacat
aaatgcgtgaacgagacgaaccagtcgagagacaaccagcaaggagattctaacatacgc
gaggaccgtgatgatcaagctgcgtcgtcttcacagcgtgggacacaagccactactctc
tcagagtatctctctgaaaatcttcgggctctgaatgcgggcgaaatgttcgctgtctac
cccctgcaagactgtccgcatttagtcacgctcaacgatgttcccccgggagggatcaat
gtaaatgtaccatgtgttgaatgtgacaggaccgaggaaaactggatctgcctgcaatgt
tacaccgtgcactgcgcccgcaatattaatcggcacgcgatggagcacgcggaggaacac
gagcatcctcttacgctcagtttcagcgatatttcagtctggtgttacggttgcgaagct
tatattgataatcctcgattatatgcagcgagaaacgcggtttaccaaagcaagtttaat
gaagagcttccctggacttatagcgagagccgcactgaataa

DBGET integrated database retrieval system