KEGG   Solenopsis invicta (red fire ant): 105203037Help
Entry
105203037         CDS       T03916                                 

Definition
(RefSeq) hexokinase type 2-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00010  Glycolysis / Gluconeogenesis
soc00051  Fructose and mannose metabolism
soc00052  Galactose metabolism
soc00500  Starch and sucrose metabolism
soc00520  Amino sugar and nucleotide sugar metabolism
soc01100  Metabolic pathways
soc01200  Carbon metabolism
Module
soc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
soc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105203037
   00051 Fructose and mannose metabolism
    105203037
   00052 Galactose metabolism
    105203037
   00500 Starch and sucrose metabolism
    105203037
   00520 Amino sugar and nucleotide sugar metabolism
    105203037
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105203037
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:soc04131]
    105203037
Enzymes [BR:soc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105203037
Membrane trafficking [BR:soc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105203037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 PTN_MK_N
Motif
Other DBs
NCBI-GeneID: 105203037
NCBI-ProteinID: XP_011170060
LinkDB All DBs
Position
Un
AA seq 491 aa AA seqDB search
MKTKNKSLFSRLCKCYNKKEMSDVRIYENRDPGPSFRDPEGCLNPTDEIRDACKDLVLSD
DQLRQVMLTLTNEIKKGLAKETHDDAIVKCFTTYVQDLPNGTEKGNFLALDLGGTNFRVL
LITLNGQNFDMKSKIYAIPQSLMLGTGTQLFDHIAQCLALFVKDLNLQNEVLPLGFTFSF
PLTQFGLTEGHLVRWTKGFDCSGVIGQDVVALLEDAISRRKDVKIDVCAILNDTTGTLMS
CAWKNQNCRIGLIVGTGSNACYVEKTKNVECAIPGNYHQHKPYMLINTEWGAFGENGALD
FVMTEFDRAIDENSINPTKQLFEKMISGMYMGELTRLVLEKLVNAGLLFGGKCPPDLKKR
GKFFTKYVSEIENDPKGRYTNCREVLAELGIQNVRDVSDQDCENVRYVCSVISRRAAHLS
SAGIATLLNKMGENNVTVGIDGSVYRFHPHFHDLMTEKINQLQNYKFDLMLSEDGSGRGA
ALVAAVASQRR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaaagaacaagtcgttattcagcaggctatgtaagtgttacaacaagaaggaa
atgtcagatgtgcggatatatgagaacagagatccgggaccgtcttttcgtgatccagag
gggtgcctaaatccaacagacgagataagagatgcctgcaaggatctggtcctatccgat
gaccagctgcggcaggtcatgctgacgctcaccaacgagattaagaagggcctggcaaag
gagactcacgacgatgcgatcgtcaagtgcttcactacatacgtgcaagatctaccaaac
ggcaccgagaaaggcaatttcctggcgctggatttgggcggtacgaactttagagtattg
ctaatcaccctgaacggtcagaatttcgacatgaaaagcaagatctatgcgatacctcaa
agtttaatgcttggaaccggtacccagctgttcgatcacatcgctcagtgtttggcgttg
ttcgtaaaagacctgaacttacagaacgaggtactaccattaggcttcacgttcagcttc
cccctgacccaattcggattgacagagggccacctagtgaggtggaccaagggcttcgat
tgtagcggcgtgatcggacaggatgtcgttgcccttctcgaagatgcaattagtagaaga
aaagacgttaaaattgatgtgtgcgcaatcctaaatgacactaccggcactttaatgtca
tgtgcttggaagaatcaaaactgtcgaatcggtttaattgtcggtactggatccaatgcc
tgctatgttgaaaagacgaagaacgtagaatgtgcaattccaggcaactatcaccagcac
aagccctatatgctcatcaacacggaatggggagcatttggcgaaaatggcgcgctagat
tttgtgatgactgaattcgatcgtgccatagatgaaaattctatcaaccctaccaagcag
ctgtttgagaagatgatctcgggaatgtatatgggtgaactgacgaggctggttctcgag
aaattagtgaacgctggccttctcttcggcggcaaatgccctcccgatctcaaaaaacgc
ggcaaattcttcacgaaatatgtatccgagattgagaacgatccaaaaggaaggtacaca
aattgccgggaagtattggccgagttggggatacagaatgttagggatgtaagcgatcag
gattgtgagaatgtaagatatgtgtgctcagtgatatcgagaagagcagcgcatctctcg
agcgcaggaatagcgacgttgctgaataaaatgggggagaacaatgtcacagtgggcatc
gacggatcggtatatcgattccacccgcattttcacgatctcatgacggagaagatcaat
caattgcagaactacaagtttgacttgatgctctcggaagacggtagcggtcgtggagcc
gctctggtcgcggcggtggcgtcgcagaggcggtga

DBGET integrated database retrieval system