KEGG   Solenopsis invicta (red fire ant): 105203744Help
Entry
105203744         CDS       T03916                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase UBR4 isoform X1
  KO
K10691  E3 ubiquitin-protein ligase UBR4 [EC:2.3.2.27]
Organism
soc  Solenopsis invicta (red fire ant)
Brite
KEGG Orthology (KO) [BR:soc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:soc04121]
    105203744
Enzymes [BR:soc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     105203744
Ubiquitin system [BR:soc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    105203744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E3_UbLigase_R4 zf-UBR SCAI
Motif
Other DBs
NCBI-GeneID: 105203744
NCBI-ProteinID: XP_025987190
LinkDB All DBs
Position
Unknown
AA seq 5291 aa AA seqDB search
MAAKSGGHDEWPSVMKPILGTSPRSFNKTDVIDLVKSIVKSENKFVSHEDQYDTFYTAVA
ALSADCISGCANTFAKSQISIVCQACKVLLAYLVDKLPQQQTQSGDTSSTALTTKQLLLP
IRALCMGQSLLTSTEETALASVIKNSKVPPYVTVLSGGKEKEPSQQPVKESMRSRCDLST
SILEQLTMPLQDFSSSSILTNESSIDNASKNTNASTGETHSDIKMMFISNNISTLQNMGA
GDTLLDMCLNLPHLSRYTRKYQAYLSKKGFSLPANASEAHTIRHSLHSVVSDINIVHNVI
SLPILEPLTPQKLEKLSLLTMSCLYCSIANATASSIVGITNAVSPKCSTNTAANSQTNQN
TKTTDEEYDTLAITVVEKSLEIFGQVSNVIKNSTRAGGHILQNHLLIGVWLLVAGLQAQL
TVSSFSAADKGKEEKGKSPSKARDGSGRVNLMKVQQGFGVLSVALASHALNLMSALLEDV
SIEANSDVVVAVPEPAPLDILSTATALQRAVTFLQAVPLNHLLFYLATISYRKACTLKRV
QKHPLEGDALSQSDSTTYYEDLLSCSENSTDEEEDSEPILGLWFEETIAPSDETSTNTNK
ETNNEASAERTTVTTIVPDNREPHGYISLATKIFQFMNKHLIGSRSTYVREYVVNGLVEQ
QMVILAAIIRDLDHETARTETGTISAFYGATLGTMYSEFSQALSRYTHNLLAWNTLSESL
QNTLLQHLGVSPWSTESNNSTTWPLQVYPRTLSVLAQVLLLKPQLEREAACISIWHRLVT
TMVENVCNPQTTYEAENEDLNVEHAQLVLFLFHSLNLMQKKSVLLVTGSGAVRCSEAVKT
PMKDFQLLHLSRLLLLLEYMMKHLYDAHPVLLEQVQWNLFSATSLVCDTKDGNKQTARAF
TPWVEIEDNYRKYGSQDEFSMKPRFYNLSRTDFNNQDAPKLDGLACNFILGTPDKMKYPL
LVDALIDILNVLNQTDMHKKNGSDNKEKITFTGLCAIQYCFSICWELLLMLPPSTPYMNK
LALGEEIPAGPMLLHSLIWGPRAAYKTFTGWMKDCLVKQGMYTQYAENLLKTVSSTVNSL
KYDVTLAKNCIISLKPEYNSTDKIMPKASLPKLGSLCILAAVVGKLQVLMDESISKNPTE
NIETSKSTQNTDSAPSNRTKMIIEILPHILSLTDAILMSCRSNILYHTLESVEEHRKYGM
RDYLILDNILSMAGANWETESSLVSFLPSCVKSALDKWKSIAFTPVPWNTYANDIIPAES
YIFTTVNYHVSSLSEHPTFSINPSLKNLLYCLVSFMNEYITSATAPEPQSDMHSQAVDIL
ISLSMDARTDYLREMATNTLTKLLGQDNDNEARLLREHLFVLNHTYNLIIEYTDNTDGSI
KVVIDEDILDQCIKYWERLLEKPLGCKALDLFFAPDSNRSLVSVLLSITSPQASTQFSTY
VFQFFSALFRTTEKPGDGSLDRLCNSVASFANVEDEKLQTWLRHVILGVTNIPTTISTTN
IPTPTAGTANTLVTVSGTSEESQKADERNNASNNEQAQWAISDGSTNQPATSNDEQLTIH
ENSRFLRALTNYIVKDKSNFSANVSITILQVLIPLTYHILSPTIEGNRFVHLMHIMSTLA
DAGLEKGHTLLFKAAIEWVELCKEQIMNKDPQSFDKPSPYIEAECCILNYIADVVGAICP
QQAQSQDRAISPPWEGAVPNNDVNDSDWVDEIPHDDDDSAAEDSDEDSLCNKLCTFTITQ
KEFMNQHWYHCHTCNMVDGVGVCTVCARVCHRGHDVTYAKYGNFFCDCGAKDDGSCQALT
KRSPQSSEHQVSNNIPYNNAGAPTENNLLLTSSLRRRASSPVHLYDKHERSGRDTQRQAY
LAKQLESSKDWISSQLSKSGLVSSLVDLTRVLVPAVDSSCQRYSPVGCHARAQLALRRLH
TLDKKFEHTDQLMLPTLGSQEGAFENVRMNYSGDQGQTIRQLLSAHMIRRVAMCCLSSPH
GKRQHLAVSHEKGKITVLQLSALLKQADSSKRKLTLTRLASAPVPFTVLSVTGNQWNEDF
LAVCGFKDCHVLTFNSSGTVSDHLVLHPQLESGNFIIKALWLPGAQTQLALVTADFVKIY
DLGKDALSPQYYFLVPTGKIRDCTFMHAEDGTFHMLLMSSAGYIYSQVMDEESQAKHGAF
YVTNTLEIYHPEIKDTGQVGGGGVSIYYSHALQLLFFSYVCGKSFIAPLKHMDSDITVVF
QINLASNKTNGNKSNNNQPQPLCQWSEVANHPGLVCSILQTSNNPVILMIKPDTIMIQEI
KIMPAKAKIMDMVAIRHPSSNAEHRTTLILLCEDGSLRIYMAGMEQTGFWMSPTVQPIST
TSGIKPTRKKKTNKMGKPSGSITFPIDFFEHCQVMNDVEFGGNDLLQIYNVAQIKHRLNT
TGMYVVSTKAMGFNVEVTNNDVILVMTGIRVLFGNQDIQKAPLYVEVFGRSIRTALTRSR
WFDIPLTREESLQADKKLTITFGPSQDQECVIMVDSIKIYGKTKDAFGWPEEIEEIQSCP
PTSAPVTTVNNETDNTIVSAPLSSMNNIYCIRTAKDSSINMERMISSILEVLESSFILSS
HDDNKTSLKTTAVDVASRLLILPTPPSVQMHTTALLAALHITKQAYHLHKDHALLSHVLE
SLKSMREANDSADIDAENFYRLVLIVRAIAVSRPHNLAKFAEQYANKSIDESTVPVFEKD
RLEARSNTKADINQHLVIQLMEILWSLHMAYPKNMALAPVVVPGLTHAEGTVHAIVEIIH
AFTICDVENNTAIAAKLYLQLLLSSDTTISFSAKHAIVRVLRPRYRRRRVYIPSPPNCST
PGVVAEIEEKSVSVPSQVSQDTVERDVEQQFDIEAVEAVDRVAVMLGAEGSQNSAAARVV
NHPLEALLGAGNFPQLLDMPPDADDEAMVELAIALSLQDHEGAADLQALRQGFQQGFPNL
QGIQSLQNLSGSTLQSLQNLAAQGLVQVPNAAQAQEGGHYSDTTASAGGSDDEGSTAATD
GSTLRTSPAEQGGSGGSKGSESGGSDSGGSAVDSMTGEHNVSGRSSAYGDNAPDSAMPPI
GIGVNQTPRSETNTLDVPTTFTTNEQEEGAEQEQGVEQESDTTGEITVKLHAIRLLLLDR
FTQFVPNLINVRGVLAIPFMQVVLMLTADLDGQDERDKACVERLLQMLVKELEMDKPDTN
NICERSNKREVHLVIMRLLSVLMSRSKYAAKTPSDNPNFVSQTTAAILSKAGIIDYCLTL
LQALLDYWKTTNTEESGTMIGGQLLKEHLTTSPPDMSPFFLRQYVKGHAGDVFEPYPQLL
TEMVLRLPYQVHKYAESTVVQPAFEQPWYFYLCEYMMSYQTPFVRRQVRKLLLFICGNKE
KYRQLRDLHALISHVQSVQQCCTTGGYDPPHARPHSINLPYDSLVELIEHLKCCVEIATS
RTGNWQRFCLKQNTVLSYLFAISTLLDEGVSPTVLQLLQCAICSNNKSKDTKDTKSKESK
STTGTKERREREKSEDSDTEAKFEEAQCLTLVEQIQKQVHPTLLMKFIQTFLLETNNTNV
RLQAHSLVLAIYKNCGPTDQEVLLDLLWRLWPLVPAYGRKAAQFVDLLGYFCLKTPHAGK
KMHTYMEQAVAVLHAQNQLLARHPNANLYVNLAQFVELDGYYLESEPCLVCNNPEVPMAT
IKLSSIKVDSKFTTTTQIVKLVGSHTISRITLRIGDLKRTKMVRTINVYYNNRSVQAVVE
LKNKPAMWHKAKKITLAQGQTEVKMEFPLPIVACNLMIEYADFYENIQASSETLQCPRCS
ASVPANPGICANCGENVFQCHKCRAINYDEKDPFLCHACGFCKYAKFDYTLTGRPCCAVD
PIENDDDRKKTVATINTLLEKADRVYKTLISNKPTLEMLLVKISEHRLDRGLEDGIQVSG
STQVNRAIQLLAQRYCGECKTSFEELSKIIQRVLACRRELVAYDRNQRGQSSSQSSYGTS
STNDVIKDETIVSPVGRCYGCASAATEHCLILLRALATKSVARDVLCKQGLIQELVEHNL
RKGTVQMQEDVRQLLCLVTRDNVQSTKEICSLLTNRITLTLRGRVATPNLSVAVRHEMAL
LAALVQKEDSCWEQKLRCVMQLFLTACKESKSPVVMESIILPCLKILQGLIKPDQPVSKK
NKDKTIESLATVQPPEDVSIDVGKWISGDPKHSYSEWLRRMPAKKTEPSTAKPLEQEEAR
VLYLMEKYGHRWHQRCMRHQGVQPLRLSDGAWLKEVLFNPSSRLARQVACNMIESLCQGI
ERKKEVLVLLTCYLEELRTAGESSTEFLTLYQSLIRQSPWKQFLAIRGVMTLLAELLTRE
IEELHRLEETTLTSDLAQGYSLKMLTELLATFLEQENIKQQYKGRLVGAVLNGYLSLRRL
VVQRTRLIDDTQEKLLELLEEMTTGTEEETKAFMAICVETIQKQNPQDVRTPVFIFERLC
SIIYPEENDIGEFFLTLEKDPQQEDFLQGRMLGNPYSSLEPGLGPLMRDVKNKICQDCEL
VALLEDDNGMELLVNNKIISLDLPVKEVYKKIWVLEGGECDAMRVIYRMRGLLGDATEEF
VETLNANSEQEVNNEEVYKMANVLADCGGLQVMLDRLAAIHDVNRARPLLQVLLKLFRLC
VKVKKNQEVLSKPELGAVTVFLDVLQRCLATESENSQAKITEQLLDIMETILANAASQPF
SAFEAFSRTLGGPEHIKALLSCTQSTAVRQSASVLAHLARVLAALTYGNKEKMALLCDYF
KPVLNFYKFDFEHTPEDEQKLELFCILTQGIERNAIGNTLKDYIISMGIVKDAFEYITVH
APCVKPTLLRTDSDELKEFISKPALKYILRFLTGLATDHDPTQLTVSQVTISIIHRLEQV
SSNEHVGSLAENLLEALCTNKRVAELIEEARQHTRSEKKRLAMAMRERQLGALGMQTNDK
GQVTASGTILQQMEDLGDETGLICVICREGYKFKPNMVLGVYTFTKRCNVEEFETKQRKT
VGYTTVTHFNVVHVDCHMSAVRLARARDEWESAALQNANTKCNGLLPLWGPQVPESAFAS
CLARHNTYLQECTSHRDISYSSTVHDLKLLLLRFAQEKSFHEDTGGGGPQSNMHIVPYLI
HMALYVVNTTRSATREDKALMTYLEVPPGSAWLDSCYEAEGPLYQCTLSLLLLTPARWKS
HRLTHLNRLLVLAHQRYVSPSATTKTIMEPSAKDYAIYKNILIFFGLVDAIYANFFKKVN
VLSDDQWPSVLAEYIRHNDEAMLKASERVLSSYRDELLPCTSFEEFCDIVGLLEDIRNPS
TYITDILRRLA
NT seq 15876 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaagagtggtggtcacgatgagtggccctcggtgatgaagccgatattggga
acgtcgccgcgttcgtttaataaaactgacgttatcgatctcgtaaagagcatcgttaaa
agcgaaaataaatttgtctctcacgaggatcaatacgatactttttacacggcggtcgct
gccttgtcggcagattgtattagcggttgcgcaaatacgtttgccaaaagtcaaatatct
attgtctgtcaagcatgcaaagtactgcttgcttatctcgtggacaagttgccacaacaa
caaactcaatctggagatacttcatcaacggctctgactacaaagcagctgttacttcca
atacgtgcattatgcatgggacagtctttacttacgtctacggaagaaactgctcttgct
tctgtaataaaaaattccaaagtaccaccttatgtaacagttttgtcaggtggaaaagaa
aaggagccctctcagcaacctgtaaaagaatctatgcgatctcgttgcgacttgtctaca
agtattcttgagcagttgacaatgccgttgcaagatttttcgtcatcttcaattctcact
aatgaaagttctatcgataatgcgagtaaaaatactaatgcttctacaggcgagacacat
tctgacattaagatgatgtttatttcaaacaatataagtacactgcagaatatgggagca
ggtgatactttgttggatatgtgtttaaatctcccacatttatcgcgttataccagaaag
taccaagcttatttatctaaaaagggattcagcttaccagcgaatgcttcagaagcgcat
acaataagacacagtttacattctgtcgttagcgacattaacattgtacataatgtgata
tctcttccgatacttgaacctttgacgccacagaagttggaaaagttgtcattgctgact
atgtcctgtctgtattgttcaatcgcaaatgcaacagcgtcaagcatagttggcataaca
aatgcagtatcacctaagtgtagtacaaatactgcggcaaatagtcaaactaatcagaat
acaaaaactaccgatgaagagtacgatactttagcaattacagttgttgagaagagttta
gaaatatttggccaagtatcaaatgttattaaaaatagcacgcgtgcgggaggacatatt
ctgcaaaatcatttacttattggagtgtggctcctagtcgctggattgcaagcgcaatta
actgtgagcagttttagtgctgcggataaaggaaaagaagaaaaaggaaaatcaccaagt
aaagctcgcgacggaagtggacgtgtaaatcttatgaaagtacaacaaggatttggtgta
ttatcagtggcattagcatcacatgcattaaatctaatgagcgctcttctggaagatgta
tctattgaagccaattccgatgtagttgtggcagttccagaaccagcgccgctggatatt
ttgtctaccgctacagcattacaaagagcagtaacgttcctacaagcagtgccattaaat
catttgttattttatctggctactattagttacagaaaggcttgtacattgaaaagagta
caaaagcatccattagaaggagatgcattaagtcaatcggattcgactacatactatgaa
gatcttttgagttgttcagagaactccactgatgaggaggaggacagcgaacctatttta
ggactatggtttgaggaaaccattgctccatcggacgagacttcaacaaatactaataaa
gaaacaaataacgaagcaagcgcggaacgcactactgttactaccattgttcctgacaat
cgagaaccacatggatacatttctcttgcaacaaaaatatttcaatttatgaataagcat
ttaattggtagtagaagtacatatgttcgagaatatgtggttaacggcttggttgaacaa
caaatggtaatattggcagcaattataagagatctagatcatgaaacagctagaacagaa
acaggcacaatttctgcattttacggtgctacattgggcactatgtattcggagttttct
caagctttaagtcgttacactcacaacttactcgcatggaatacactaagcgaatctctg
caaaatactttacttcaacacttgggagtgagtccttggtccactgaaagcaataattct
actacgtggcctctacaagtgtatccacgaactctcagcgtattggcacaggtattgttg
ctgaaacctcaattagaaagggaggctgcgtgtataagcatatggcatcgattagtaaca
actatggttgagaatgtttgcaatcctcaaacaacatatgaagctgaaaacgaagattta
aacgtcgaacatgctcaattggttctctttttatttcattctctgaatttaatgcagaag
aaatctgtattacttgtaactggaagcggcgcagtgcgttgcagcgaagcagtcaaaacg
ccaatgaaagattttcaactattacacttatcccgactgttgctgttgcttgaatacatg
atgaagcatctgtatgatgcgcatccagtattgcttgaacaagtccaatggaatctattc
tctgcgacaagtttagtatgtgatacaaaagatggaaacaaacaaactgccagggctttt
actccttgggtagaaatagaagataattatcgtaaatatggttcacaagatgaattctca
atgaaaccacgtttttataatttatcgagaacagattttaataaccaggacgcaccaaag
ttggatggattggcctgtaactttattttgggtactccagataaaatgaaatatcctctc
ttagttgatgcgttgatcgacatcttgaacgtacttaatcaaactgatatgcacaaaaag
aacggttctgataacaaggaaaaaattacatttactggactatgcgcaattcaatattgc
ttttctatatgctgggaattattattgatgttacctccctcgactccttacatgaataaa
cttgctcttggtgaggagataccagctggacctatgctactccattcgttaatatgggga
ccgagagctgcgtataaaactttcactggttggatgaaagactgtttagtgaagcaagga
atgtatacgcaatatgcggaaaatttgttaaaaacagtatcgtccaccgtaaactctctt
aaatacgatgttactcttgcaaagaattgtattatttcacttaaacctgagtataactct
actgacaaaataatgccgaaagcatcattgccaaagcttggctcattatgtatactggct
gcagttgtaggaaagctgcaagttcttatggatgagagtatatcgaagaatcctactgag
aatattgaaacatctaagagtacgcagaatacagattctgcaccttcaaacagaactaaa
atgataatcgagattctaccgcatattttatcattgacagatgccattttaatgtcatgt
cgatccaacatattataccatacgcttgaatctgttgaagaacatagaaaatatggtatg
cgagattatttgattctggacaacattttatccatggcaggtgcaaattgggaaacggag
tcatcattagtttcattcttgccaagttgcgttaaatctgcactggataaatggaagagt
atcgcgtttactcctgtgccctggaatacatatgcaaatgatataatacctgcagaaagc
tatatttttactacggtgaattatcacgtcagttccttatctgaacacccaacgttctct
attaatccatcgttgaagaatctgttgtattgcttggtctcttttatgaatgaatacatt
acttcagcaacagctccggaaccacaatccgatatgcattctcaagctgtggacattctc
atttcattgtcaatggatgcccgtactgactatctacgagagatggctaccaacactctg
actaaattattgggacaggataatgataatgaggcacggcttttgcgcgaacacttgttt
gtgctaaatcatacttacaatcttataatcgagtataccgataatacagacggatctatt
aaagttgttattgacgaggatattttagatcaatgtataaaatattgggaacgattgtta
gaaaagcctcttggatgtaaagctttagacttgttctttgctcccgactcaaatcgtagt
ctcgtgtccgtcttgttatctataacgtcgcctcaagcctcgacgcagtttagcacgtac
gttttccagtttttcagcgctttattcagaacgactgaaaaaccgggtgacggatcactc
gatcgtctttgcaattcggtggctagttttgccaatgttgaagacgagaaactgcaaaca
tggttaagacatgttatactgggagtaacaaatataccaacgactatttctacaacgaat
ataccaacacctacagccggtactgcgaatacattggtaacagtttctggcacatcagaa
gaaagtcagaaagcggatgaaagaaataacgcatctaataacgaacaagctcaatgggca
atttccgatggttctactaatcagcctgcaactagtaacgacgagcagcttacgattcat
gagaacagtcgtttcttgcgggcacttacaaattatatagtgaaagataaaagcaatttc
agtgcaaatgtttcgataaccattcttcaagttctcataccattaacatatcatattcta
tctcctaccatcgaaggtaatcgatttgtacacttaatgcacattatgtctacgctagct
gatgctggactagaaaaaggacacacattattgttcaaagctgcgattgaatgggttgag
ctttgcaaggagcagataatgaataaggatccgcaatctttcgacaaaccgtctccatac
atcgaagcggaatgttgtatattgaactacatagccgacgtagtaggcgcgatttgccca
cagcaggcgcaatcccaagatcgagccattagtccaccgtgggaaggtgctgtacctaat
aacgatgtgaatgatagcgactgggtggacgaaattccgcatgacgatgatgatagcgcg
gccgaggattcggacgaggacagtctctgtaacaaactatgtactttcacgatcacacaa
aaggagtttatgaatcagcattggtaccattgccatacgtgtaacatggtcgacggagtc
ggagtttgcacagtatgcgcacgagtctgtcatcgtggtcatgatgttacgtacgccaaa
tatggaaatttcttttgtgattgcggtgctaaggatgatggatcatgccaagcattgaca
aaacgtagcccgcagagttcggaacatcaagtgagcaataacataccgtacaacaatgct
ggtgcacccacggaaaacaatctacttctcacgagcagcctgcgccgaagggcttctagt
cctgtgcacttgtatgataaacatgagagaagcggacgcgacactcaaagacaagcatat
ttagcgaagcaattggaatcgtctaaggattggatatcttcccaactatcgaagagtgga
ttggtatcttcattggtggacttgactcgcgtgttggtacctgctgtggattcatcctgt
cagcgatattcaccggttggttgtcatgcacgagctcaattagcacttagacgtttacac
actctcgacaagaagtttgaacatacggatcaacttatgttaccaactttgggatcccag
gagggcgcatttgaaaatgttagaatgaattattcgggagatcaaggtcaaacgattaga
cagttgctgtccgcgcatatgatccgacgtgttgccatgtgttgtttgtcgtctccacat
ggtaaacgacagcacttggctgtctcgcacgaaaaaggcaagataacagtgttacaactt
agtgcattgctgaagcaagctgactcatctaaaagaaagttaactcttacgagacttgcc
tcggctccagtacctttcaccgtcctttcggtcactggaaatcaatggaacgaggatttc
ttggctgtttgtggcttcaaggattgtcatgtacttacgttcaatagttctggaacggta
tctgatcatttagtgttacatccacagcttgaaagtggaaatttcattattaaggcgctg
tggcttcctggcgcacagacgcaattggcgttagtcactgctgattttgttaaaatttac
gatttgggaaaggacgccttgagcccacaatattatttcctcgtgccgacgggaaaaata
agagattgcacttttatgcatgcggaagatggtacattccacatgttactcatgtcttct
gctggttatatctatagccaagtaatggacgaagagagtcaagccaagcatggtgctttc
tacgtgacaaatacgttagaaatttatcatccggaaatcaaagacactggtcaagtaggt
ggtggaggtgtctctatttactattctcacgctctgcagttattattcttcagttatgtt
tgcggtaagagtttcatagcgccgttaaaacacatggactccgacattacagtggtattc
caaattaatctcgccagtaacaaaacaaacggcaataaatctaacaataatcagccgcaa
ccactgtgccaatggagcgaggtggcgaatcatcctggattggtttgctccattttacag
actagcaataatccagtgatactaatgattaaacccgatacaatcatgatacaagaaatc
aaaattatgccggcgaaggcaaagatcatggatatggttgctattcgtcatcccagttcg
aatgcagagcaccgcacgacactgatactattgtgtgaagacggaagtctgagaatctac
atggctggtatggaacagactggattttggatgtcacccactgtgcaaccgatcagcact
acttccggtatcaaaccgacgcgaaagaagaaaacaaataagatgggaaaaccatcggga
tctattacatttcctattgatttcttcgaacattgtcaggtgatgaacgacgtcgagttt
ggcggtaacgacctactgcagatttataatgttgcgcagatcaagcatcgtttaaacacc
accggaatgtacgtggtctccacgaaagctatgggctttaacgtggaagttacgaataac
gacgtgattttagtaatgacgggaataagagtactctttggcaatcaggacattcaaaag
gcacctctgtacgttgaggtatttggtagaagtattcgaactgcactaaccagaagccgg
tggtttgacatacctctaacgagggaagagagtctccaagctgataaaaaattgaccatc
acttttggaccatctcaagatcaagagtgtgttattatggtcgattccatcaaaatttat
ggcaaaaccaaggatgcatttggatggcctgaagaaatagaagaaattcaatcttgtcca
ccaacatccgcaccagtgacaacagtcaataatgaaactgataataccatcgtttctgca
ccattatcctcaatgaacaacatatattgtatcagaactgcaaaggatagttcgattaac
atggaaagaatgatatccagtattcttgaagtcttggaatcttcatttatcttatcctcg
catgatgacaacaaaacttcattgaaaactacagctgtcgatgttgcatcgcgattatta
atattacctaccccaccatcagtacaaatgcatacgacagctttgttagctgctcttcac
atcactaaacaggcttatcaccttcacaaggatcatgcattgttatcacatgtacttgaa
tccttgaagtcaatgagagaagctaatgattctgcggatatagatgcggagaacttttac
agacttgtacttatcgttcgtgctattgccgtttctcgcccgcacaatctcgcgaaattt
gctgaacaatatgcaaataaatcaattgacgaaagcacagtgcctgttttcgagaaagat
cgcctagaagctcgttcgaacacgaaagctgatataaatcaacatctggttatccaattg
atggagatactgtggtctctacatatggcgtatcccaaaaatatggcgcttgctccagta
gtcgtgccgggtcttacgcatgccgaaggaacggttcatgcaatcgtggagataattcac
gcttttacaatatgcgatgttgaaaataataccgcaatagctgccaagttgtatctgcag
ttgttactgtcgtcagatactaccattagttttagcgccaagcacgcgatagttagagtg
ctgaggcctagatacagacgcaggagagtgtatattccaagtccgccaaactgcagtact
ccaggtgtagttgctgaaattgaagaaaaatctgtgtctgtaccgtcacaagtatcccaa
gacacagtagaacgcgatgtggaacagcagtttgacattgaagccgtcgaagcagtagac
agagtggcagttatgcttggcgccgaaggcagtcaaaattcggccgccgcgagagtagtt
aatcatccgttagaagcgctacttggtgcggggaatttcccacagttgcttgatatgccg
ccagacgccgacgatgaagcgatggtcgaacttgcgatagccctcagtttacaagatcat
gaaggggctgctgatctgcaagctttgcggcagggattccagcaaggcttccctaatttg
cagggtatacaaagtcttcagaatttaagtggttccacattgcaaagcttgcaaaattta
gcagcacaaggattggtccaagtgccaaatgctgctcaggctcaagaaggtggacattac
tctgatacgactgcttctgcgggtggttctgacgacgaaggatcaactgctgccaccgat
ggtagtactcttcgaacttctcctgctgaacaaggtggtagtggtggtagcaagggtagc
gagagcggtggaagcgatagcggaggcagcgccgttgacagcatgacaggggaacataat
gtttctggcaggagctccgcatatggagacaatgctcccgacagtgctatgcctccgatt
ggaattggagtcaatcaaacgccacgctctgaaactaatactctagacgtacctacaact
tttactactaatgagcaagaagaaggtgccgagcaagaacagggcgttgaacaagaaagt
gacacaactggcgagatcactgtgaagctacatgctatacggcttttattgttggataga
tttacacaatttgtgcctaatctaataaatgttcgaggagtgcttgccattccatttatg
caggttgtattaatgttgactgctgatcttgacggtcaagacgaaagagataaagcatgc
gtagaacgtttgttgcaaatgctcgtgaaagaactagaaatggataagcctgatacaaac
aacatatgcgagcgtagcaataaaagagaagttcatttggttattatgcgtttactaagt
gttcttatgtctcgctcgaaatatgccgcaaagactccttcggacaatccaaattttgtg
tcacaaactactgctgcaatattgagcaaagctggcattatcgattattgtctaacttta
ttacaggccttgcttgattattggaaaacaaccaatacagaggaatctggtactatgatt
ggaggtcaattactcaaggaacatcttacaacatcgcctccggatatgtcaccgttcttt
ttgagacaatatgttaaaggtcacgctggcgatgtattcgaaccttatccccaattattg
acggaaatggtactacgattgccgtatcaagtgcacaaatacgcagaaagtaccgtggta
caacccgcattcgaacagccatggtatttctacctttgtgagtacatgatgtcgtatcaa
acaccatttgtcaggcgacaagtacgtaaattgttgctcttcatatgtggcaataaggag
aaatatagacaattacgggatcttcatgctcttatatctcacgtgcagtccgtacaacag
tgttgtactaccggtggttacgatccgccgcatgctcgtccgcattccatcaatctgccg
tacgactctttagtggaactgatcgaacatttgaaatgctgcgtggagattgctactagt
cgcacaggaaattggcaacggttttgcttaaaacaaaacacagttctgtcgtatctcttt
gccatatcaacacttttggacgaaggcgtgagccctacagttcttcagttgttgcaatgt
gctatttgttcaaataacaaatctaaagatacaaaggacactaaatcaaaggaatcgaaa
tcgacgactggcacaaaagagaggcgtgaacgtgaaaaatcagaagattctgatacggag
gctaaattcgaagaagcacaatgtttaactctagtggagcaaattcaaaagcaagtgcat
cccacattactgatgaaatttatacaaactttcctccttgaaacaaataatacgaatgtt
cgtttacaagcacattcgcttgtactagcaatttacaaaaattgtggaccgacagatcag
gaagttttgttagatcttttatggcgtttgtggcctctggttccagcttatggcagaaaa
gcagcacagtttgtcgatttacttggttacttctgtttaaaaacaccgcatgctggaaag
aagatgcacacgtatatggagcaggcggttgccgttttacacgcgcagaaccaattactc
gcgcgacatcctaacgcaaatctttacgtcaatctggcacagtttgttgaattggacggc
tattacttggagagcgagccttgtcttgtatgcaataatccggaagtaccgatggcaaca
attaagctgtcttcaattaaagttgattccaaatttacaacgacaacacaaattgtgaag
ttagttggcagtcacaccattagtcgcattactctgcgtataggcgatttaaagagaacg
aagatggttcgtaccatcaatgtctattacaacaatcggtcggtgcaggctgtcgtagaa
ttgaaaaataaaccagcgatgtggcacaaagcaaagaagattacgcttgcccaaggacag
acggaagtcaaaatggaattcccgctgccgatagtcgcttgcaatctcatgattgagtat
gccgatttctacgagaatattcaagcctcatccgaaacattgcagtgtccgcgatgttcc
gccagtgtgccggcgaatcccggcatatgcgcgaattgcggcgaaaacgtgttccaatgc
cacaagtgccgagcaattaattatgacgagaaagatccgttcttgtgtcacgcttgtgga
ttctgcaaatatgcaaaattcgattacaccctgaccggtagaccgtgctgcgccgttgat
cccatagaaaatgatgacgatcgaaagaaaacggtagcgaccattaatactctactagag
aaagcggaccgagtatataaaacgttgatatctaataaacctacgttagaaatgcttctt
gttaagatatccgagcatcgtttggatcgaggattagaagacggtatacaggtgtctggc
agtacccaagtgaacagagcgatccaattacttgctcagaggtactgcggcgaatgtaaa
acctccttcgaggaactcagtaaaattatccaacgtgtcttagcctgtcgcagagagctc
gttgcgtacgatagaaatcaacgtggtcaaagtagctcgcagtcgtcgtacggtacgtcc
agtacgaacgatgtcataaaggacgagacgatagtttcaccagtcggacgttgttacgga
tgtgcgtctgccgcaacggaacactgcctcatactattacgcgcattagccaccaaaagc
gtagctagagacgtactgtgtaaacaaggactaatccaagaactcgtagaacacaatttg
cgaaagggtacggtacaaatgcaagaagacgtgcgacaactattgtgccttgtcacgaga
gacaatgtgcagtcgactaaagagatatgttcactcttaactaatcgaatcacgctgaca
cttcgtggacgagttgccacacctaatctctcggtcgctgtacgacatgaaatggctctt
ctcgcggcactcgtgcaaaaagaggattcgtgctgggaacaaaaattgcgatgcgtaatg
cagctatttttaacggcttgtaaagagtcgaaaagtcccgttgtaatggaaagtatcata
ctaccgtgtctgaaaattctgcaaggtctcattaaacctgatcaaccggtgtcgaagaaa
aataaagataaaaccatcgaatctctggcgactgtacagccaccggaagacgtcagtatt
gatgtgggtaaatggatcagcggcgatcccaagcattcgtattccgaatggcttcgccgc
atgccggctaagaaaacggaaccatctacagctaaacctcttgagcaggaggaggctcgt
gtgttgtatctgatggaaaaatacggccataggtggcatcaacgttgtatgagacatcaa
ggcgttcaaccgctgagactgtcagatggtgcttggttgaaggaagttctctttaatccc
agttctcgtctggcacgtcaagtcgcttgtaatatgattgagagtctgtgccaaggcata
gagaggaaaaaggaggttctcgttttactgacgtgttatttggaagagttacgtactgcc
ggcgagagcagcaccgaattccttacgttgtatcaaagtttaatcagacaatcaccttgg
aaacaattcctagcaatacgtggtgtaatgactttattggcggagcttttgactcgagaa
atagaggaattacacagactagaggagactactttgactagcgatcttgctcaggggtac
tcgttgaagatgctcacggaacttctggcaactttcttggaacaggaaaatatcaaacag
caatataagggcagattggtcggtgcggtgttaaatggttatctatcacttagaagactt
gttgttcaacgtactagactaatcgatgatacgcaagagaagctgttagaacttctggaa
gaaatgactaccggcaccgaagaggaaactaaagcattcatggcaatttgcgttgagacg
atacaaaaacagaatcctcaagatgttcgtaccccagtatttatatttgaaagattgtgt
tcaattatctacccggaagaaaatgatattggagaattcttcttaacacttgagaaggat
ccacagcaagaagatttcttgcaagggagaatgttaggaaatccttatagcagcttagaa
cctggccttggtccacttatgcgagatgtcaaaaataaaatttgtcaagattgcgagtta
gttgcacttttagaggacgataatggaatggaacttctcgttaataacaaaattatcagt
ctggatcttccagttaaggaggtttataagaagatttgggtattggaaggcggagaatgc
gatgctatgcgcgtaatatatcgtatgcgtggcttgcttggagacgcgactgaagaattt
gttgaaactttgaacgccaatagtgagcaagaggtgaacaacgaggaagtttataaaatg
gctaatgtattagcagattgcggcggtcttcaagttatgttagacagattggcagcgata
catgatgtaaatcgcgcaagacctcttcttcaagtgctgttgaaattattcagattgtgt
gtgaaagtaaagaagaatcaagaggttttaagtaaacccgaattaggagcggtaaccgta
tttttagatgttcttcaacgttgtctcgctacagagtcggaaaattctcaagcgaaaatc
actgaacagttattggacattatggaaacgatattggcaaatgcggcatcacaaccgttt
agtgcgtttgaagcattttcacgtactctcggtggcccggaacatatcaaggcgctctta
tcatgtacacagtccacagcggtcaggcaaagtgctagtgtgctcgcgcaccttgcgaga
gttttggcagcgttgacttacggcaataaagagaaaatggcgcttttatgtgattacttt
aaacctgtattaaacttttacaaatttgattttgaacacacgcctgaagacgagcagaag
ctagaactgttctgcatactcactcaaggcattgaacgaaatgccattggtaatacgttg
aaagattacatcataagcatgggcatagtaaaagacgcctttgaatatatcaccgtgcac
gctccatgcgttaaacccacgctattacgcacagatagcgacgagctaaaggaattcata
tctaaaccagctctgaaatatatcctacgcttcctcacagggttagctacggatcatgat
ccgactcaattaacagtctcgcaagtaactatcagcattatccatcggctggaacaagta
tcttcgaacgaacatgttggctcattagcggaaaatttgttggaagcattatgcaccaat
aaacgggtagctgaactcatcgaagaagcccgccagcatacgcgtagcgagaagaaacgc
ttagctatggcgatgcgtgagagacaattgggcgcacttggtatgcagactaacgataag
ggtcaggtcaccgccagtggaacaattctacaacagatggaagacctgggcgatgagact
ggactgatttgtgttatctgtcgcgaaggatacaagtttaagccaaatatggtattgggt
gtttatacattcacgaagcgctgtaatgtagaagaatttgaaacaaagcaacgaaaaact
gtgggttacacgaccgtcacgcatttcaatgtggtccatgtagactgtcatatgtctgcg
gtacgtttggcgcgcgctagagacgaatgggagagtgcggcgttacagaacgctaataca
aaatgcaatggattgctgccgttgtggggcccacaggttcccgaatctgcattcgctagc
tgtttagctaggcacaatacctatttacaagaatgcactagtcaccgcgatatatcttat
tcatcgacagttcacgatctgaaactgcttcttttgcgattcgctcaagagaagagtttt
cacgaggacactggtggtggaggtccccaatcgaatatgcacatagtgccgtatttaata
cacatggctctatatgttgttaatacaacacgatcggcaactagagaggataaagcttta
atgacttacctggaagtaccgccaggctcagcgtggctcgatagttgttacgaagcagag
ggtccattgtatcagtgcacactttcgctacttctacttacacccgctcgttggaaatcg
catagacttacacacctcaatcgactactcgtcttagcacatcagcgttacgtgtcccct
tcagccactacaaagaccatcatggaaccaagcgccaaggattacgctatttacaagaac
attctaatcttctttggtctagtggatgctatttatgcaaacttcttcaagaaagtaaat
gttttatccgatgatcagtggccttcggttttggctgaatacatcagacacaatgacgaa
gccatgttaaaagcctcggaacgcgtgctttcatcgtatcgcgatgaattattaccatgc
acatcattcgaggaattttgcgatattgttggcttattagaagatataagaaatccctct
acgtatattaccgacatcctgcgacgccttgcttga

DBGET integrated database retrieval system