KEGG   Solenopsis invicta (red fire ant): 105203823Help
Entry
105203823         CDS       T03916                                 

Definition
(RefSeq) pyrimidodiazepine synthase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00480  Glutathione metabolism
soc00980  Metabolism of xenobiotics by cytochrome P450
soc00982  Drug metabolism - cytochrome P450
soc00983  Drug metabolism - other enzymes
soc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105203823
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105203823
   00982 Drug metabolism - cytochrome P450
    105203823
   00983 Drug metabolism - other enzymes
    105203823
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:soc02000]
    105203823
Enzymes [BR:soc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105203823
Transporters [BR:soc02000]
 Other Transporters
  Pores ion channels [TC:1]
   105203823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin Tom37
Motif
Other DBs
NCBI-GeneID: 105203823
NCBI-ProteinID: XP_011171042
UniProt: E9IBL2
LinkDB All DBs
Position
Unknown
AA seq 239 aa AA seqDB search
MGSLHLADGSEKPAEVEGQARLYSMMYCPFAHRIRLLLSLKQIPHDIVNINLQSKPQWFL
QIHPDGKVPIFIDSDGTIITESVEVANYLDKKYPEPPLYNDETKSRDLELLDHFSKIMDI
FANCIFEKDKRPFEEILTEVTNLLQEFENELNVRKTTFFGGSNPNMLDILIWPWFERAKA
LTLLYKQRASLDKERFPRVMEWVDGMKDQPFVLQHRCSYEKFAKFVEAARTGNVDYDNL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggttctttgcatctagcagatggctccgaaaagccagcagaagtggaaggtcaggcg
cgtttgtacagcatgatgtattgcccctttgctcaccgaatacgcctcctgctcagtttg
aagcagattccgcatgacattgtcaacatcaacctgcagagcaagccgcaatggtttctt
caaattcatccagatggtaaggtaccgattttcatagattcggatggtacaataataacg
gagtctgtcgaagtggcgaattacttggacaagaaatatcccgaaccacctttatacaac
gacgagacgaaaagtcgcgatttagagttgttagatcacttttccaagattatggatatc
tttgcgaattgcatatttgagaaagacaagagaccatttgaagagattcttactgaggtg
acgaacctcttacaagaatttgaaaatgagcttaatgtacgtaaaacaactttctttgga
ggaagtaatccaaatatgttggatattctaatatggccttggtttgaacgcgcaaaagct
cttactctactttacaaacagcgtgcaagtcttgacaaggagagattcccccgtgttatg
gaatgggtagatggaatgaaagatcagccatttgttttacaacatagatgctcatatgaa
aagtttgcaaaattcgtagaagctgcaagaacgggaaatgttgattatgataatctttaa

DBGET integrated database retrieval system