KEGG   Solenopsis invicta (red fire ant): 105204005Help
Entry
105204005         CDS       T03916                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase isoform X2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00010  Glycolysis / Gluconeogenesis
soc00030  Pentose phosphate pathway
soc00051  Fructose and mannose metabolism
soc00052  Galactose metabolism
soc01100  Metabolic pathways
soc01200  Carbon metabolism
soc01230  Biosynthesis of amino acids
soc03018  RNA degradation
Module
soc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105204005
   00030 Pentose phosphate pathway
    105204005
   00051 Fructose and mannose metabolism
    105204005
   00052 Galactose metabolism
    105204005
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    105204005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:soc01009]
    105204005
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:soc03019]
    105204005
Enzymes [BR:soc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     105204005
Protein phosphatases and associated proteins [BR:soc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105204005
Messenger RNA biogenesis [BR:soc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     105204005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 105204005
NCBI-ProteinID: XP_011171288
LinkDB All DBs
Position
Unknown
AA seq 822 aa AA seqDB search
MDYYEDCYQSYKEYCDTVMAEDAPAQKFIRPGSHKGKGIAVFTSGGDSQGMNAAVRAVVR
MGIYLGCRVYFIREGYQGMVDGGPNIEEATWSAVSCIIHKGGTVIGSARCQEFRERPGRR
KAAKNLVNLGITNLVVIGGDGSLTGANLFKEEWPSLLKELAESGDITAEQLEKYKHLHIV
GLVGSIDNDFCGTDMTIGTDSALHRIIESIDAIASTAYSHQRTFIMEVMGRHCGYLAIVG
ALASEADYVFFPECPPPVDWPEKLCKKLEQERLTGQRLNIIIVAEGAVDRNGDPITADKV
HKVVVEKLQQDTRVTVLGHVQRGGNPSAFDRVLGCRMGAEAVMALMEATPDTEACVITLD
GNQAVRLPLMECVRRTKAVAQAMADKNWDLAVQLRGKGFERNLDTYKMLTRLKAPHLVDL
NKEVNGRTLPKQYTLCGQDHYTLAVMHIGSPSCGMNAAVRSFVRNCIYRGDKVYGIGDGV
LGLIAGRLKLMDWPSVTGWVSEGGAKLGTKRAPPTEDQLPQIAQKLKEFEIQALLIIGGF
EGFQTGLTFYKARDKYDEFRIPIAMIPATISNNVPGTEFSLGCDTASNEITEICDRIRQS
AQGTKRRVFIIETMGGYCGYLATIAGLAGGADAAYIYEEKFNIKDLNQDVIAMAAKMSEG
VERGLIIRNENANENYNTEFMFRLFSEEGKGLFSCRRNILGHMQQGGSPTPFDRNLGTKM
GSKAVEWFSDQLRKCTSPEGKTFTTAADSAVMLGIVRRQYRYTPFMELMEVTDFEHRIPT
YQWWMKLRPLLKVLAKHESTYEEEGLYITVEEMDEQKDPPLV
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggactactacgaagattgttatcagagctataaggaatactgcgatacagtcatggcc
gaagacgcgccagctcagaagtttataagacctgggagtcacaagggcaagggcatcgcc
gtgttcaccagtggaggcgactctcagggaatgaatgccgctgtacgagcggtcgtgagg
atgggcatttatctcggttgtagggtgtactttatcagggaaggctatcaaggcatggtg
gacggtggaccaaatatcgaggaagctacatggtcagccgtgtcttgcatcattcacaag
ggtggtacagtaatcggttctgctcgatgccaagaattcagggagcgtcctggtcgtcga
aaagccgctaagaacttagttaatctgggcataactaatttagtagtgatcggtggagat
ggctctctcacgggtgcgaatctctttaaagaggagtggccctcgcttctgaaggagctg
gctgaatcaggtgacataactgccgaacaattagagaagtacaagcacttgcacatcgtc
ggtctagtaggttccatcgataacgatttttgcggtactgatatgacgattggtaccgat
tccgcgttgcatcgtatcattgaaagtatcgatgctatagctagtacagcctactcgcat
cagagaacgttcataatggaagtcatgggtcgtcattgcgggtatctggctatcgtgggc
gctttagcttcggaggcagactatgttttcttcccagaatgtccgcctcccgtcgactgg
cctgaaaaattatgtaaaaaattggagcaggaaagacttactggtcaacggcttaatatt
attattgtggctgaaggagctgtcgacagaaacggtgatccaatcactgctgataaggtg
cacaaagttgtcgtggagaaattgcagcaggatacgagagttacagtcttgggtcatgta
caaagaggtggcaatccttcagctttcgatagagttttgggatgccggatgggagctgaa
gccgtgatggctttaatggaagcaacccccgatacggaagcctgcgttattacgttggac
ggtaatcaagccgtaagattaccacttatggaatgtgttcgtcgtacgaaggccgtggcg
caggctatggctgataaaaactgggatcttgctgttcaacttcgaggaaagggctttgag
cgtaacttggacacgtacaaaatgttgactcgtttgaaagcgccgcatctagtagatctt
aacaaggaagttaatggccgcacattaccgaagcaatacactttatgtggacaagatcat
tatacgttggcggtcatgcacataggatcgccgtcttgcggcatgaacgcggcggttcgt
tccttcgtgaggaattgtatctatcgaggcgataaggtatacggtatcggcgacggagtg
ctgggcctgatagctggtagactgaaattgatggactggccgtccgtcaccggctgggtc
tcggaaggtggcgcgaaattgggaacgaagcgcgcaccgcccacggaggatcagttgcct
caaatcgctcagaaacttaaagaatttgaaatacaggcattgcttatcataggtggattt
gagggttttcagaccggtctcacattttacaaggcaagggacaagtacgacgagttcaga
attcctatcgctatgattcccgcgaccattagcaacaatgtaccgggcaccgagttttca
ttgggctgcgacacagcttcgaatgaaattacggaaatttgcgatcgcattcgacaatcg
gcgcaaggtactaaacgtcgcgtgtttataatcgagacgatgggtggttactgcggatat
ttagcgaccatcgctggtctagccggtggcgccgacgcggcgtacatctacgaggagaaa
tttaacattaaagatttgaatcaagatgttatcgcgatggcggcaaagatgtcagaaggc
gtcgagaggggtctcattatcagaaacgagaatgccaatgagaattacaatacagagttt
atgtttagactttttagcgaggaaggaaagggtctattcagttgtagaaggaatatactc
ggtcacatgcagcaaggaggctcgccaacgcctttcgaccgtaacttgggtacgaagatg
ggttctaaggcggtggaatggtttagcgaccaattgagaaaatgcactagtcccgaaggc
aaaacgttcactacggcagcggacagcgcggtgatgctcggtatcgtcagacgtcagtac
agatatacaccattcatggaacttatggaagttaccgactttgagcatcgcattccgaca
tatcaatggtggatgaagttgcgtccgttattaaaagtattggcgaagcacgagtcgacg
tacgaagaggagggtctttacataaccgtcgaagagatggacgaacaaaaggatccgcca
cttgtataa

DBGET integrated database retrieval system