KEGG   Solenopsis invicta (red fire ant): 105204089Help
Entry
105204089         CDS       T03916                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc04146  Peroxisome
soc04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:soc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105204089
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105204089
Enzymes [BR:soc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105204089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu Cytomega_TRL10
Motif
Other DBs
NCBI-GeneID: 105204089
NCBI-ProteinID: XP_011171434
LinkDB All DBs
Position
Un
AA seq 210 aa AA seqDB search
MIRMIALLVAAVIAVSATQAEEELVAVVRLMSYSSSRNVTGNLKIVQNPRDGPVTITGKI
YGLTEGLHGFHVHEKGDVSMGCMSAGAHFNPENVTHGAPEDTVRHVGDLGNIQADAAGEA
TINITDNIISLKGSNSIVGRAIVVHSGEDDLGKGNNSLSLTTGNAGDRWACGIVGIESPY
ARWNSGSFTTPSVSILVIFFLIATYQHFKF
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaatgattgcgttactagtggcagctgtaattgctgtttcagctacacaagcg
gaagaggaattggtggcagtcgttcgtttaatgtcatattcttcctcgagaaatgtcacg
ggtaatttgaagatcgttcagaacccccgggatggaccggttactatcactggcaagatc
tatggactcacagaagggctacatggtttccatgtgcacgagaagggagacgtgagcatg
ggttgcatgtccgcaggagcgcatttcaaccctgagaacgtcactcacggcgcgccggaa
gacactgtcagacatgtcggcgatctaggaaacatccaggccgatgctgcgggagaagca
acaataaatatcactgacaatatcatctcgttgaaaggatcgaacagcatcgtcggccga
gccatagttgtgcactccggcgaggacgatcttggcaagggcaataactctctctctttg
acaactggaaatgctggcgatcgttgggcctgtggtatcgttggcatcgagtcgccgtac
gccaggtggaattctggttcatttactacgccgagcgtatcgatcctcgtgatattcttc
ctcatcgccacttatcaacatttcaagttttaa

DBGET integrated database retrieval system