KEGG   Solenopsis invicta (red fire ant): 105205170Help
Entry
105205170         CDS       T03916                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SMYD3-like
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00310  Lysine degradation
soc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105205170
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:soc03036]
    105205170
Enzymes [BR:soc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     105205170
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     105205170
Chromosome and associated proteins [BR:soc03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105205170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HD_2 Luteo_PO TPR_1 RIG-I_C TPR_12 TPR_2
Motif
Other DBs
NCBI-GeneID: 105205170
NCBI-ProteinID: XP_025988999
LinkDB All DBs
Position
Unknown
AA seq 325 aa AA seqDB search
MFIWSTDYSDIIVDKKRMEHFNKIHKILFQLLDETLMPNTSELISIYGKLCTNRFGIVNE
SLNDLGIGLYLGASIMDHSCKLNAIASFKGTTVIVRTLTDLPSVDWSQIRITYVNLLNSN
KDRREELYNSYYFWCDCERCKEKEPMAACPNSSCDWPCSIEDDKCEKCSARISAEFKKNF
QEVMDFIEDCLEKMKTTTYVNDKLSLSKKCLEKQKNVMHKFNIQHVRTLERVFITATNQL
YWQDVEFYGKKLVPGYKLYFGEVHSDTGMLYMYIGMAQRHLGKSNEALETLNKAKTVLKI
SYGEKNSFVSTQMATMDVMESCAIN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttatctggtctacagattattcggacataatagtggacaagaagcgaatggaacat
ttcaacaagatacacaaaattttattccagttactcgatgaaacactcatgcctaatact
tcggagttaataagtatttatggcaagttgtgtactaaccgttttggcatagtgaatgag
tctctgaacgatcttggtattggcctttatctgggagcatctatcatggatcacagttgc
aaacttaacgcaatcgcctctttcaaagggaccactgtcattgtcagaacattaacggat
ctaccttctgtggattggtcacagataagaataacgtatgtcaatttacttaattctaat
aaggacagacgcgaggaactgtacaattcgtactatttctggtgtgattgtgaacggtgc
aaagaaaaggaaccaatggccgcttgtccaaattcatcgtgcgattggccatgttcgatt
gaagatgataaatgcgagaagtgcagcgcgagaatatctgcagaatttaagaaaaatttt
caagaagttatggactttatcgaagattgtttggaaaaaatgaaaactacgacttatgtt
aacgataagttgtctttgagtaaaaagtgtttggagaagcagaagaatgtaatgcataaa
tttaatatacaacatgtccgtactctcgaaagggtgtttatcacagcaacgaaccagtta
tattggcaagatgttgaattttatggcaagaaacttgtgccaggatataaattgtatttt
ggagaagtacactctgacacaggcatgctgtatatgtacatagggatggcacagcgacac
ttaggaaaatcgaatgaagcgctcgaaacattgaacaaagcaaaaacggtgttaaagata
tcgtacggtgagaagaactctttcgttagcactcaaatggctactatggatgttatggag
tcatgtgccatcaattaa

DBGET integrated database retrieval system